Gene Information

Name : SCAB_81311 (SCAB_81311)
Accession : YP_003493618.1
Strain : Streptomyces scabiei 87.22
Genome accession: NC_013929
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 9022283 - 9022561 bp
Length : 279 bp
Strand : -
Note : -

DNA sequence :
TTGCGTGAGCGTGCGGTACGGATGTACCGCACCACCGAGCCGAAGCCGCAGATCAAGAAGCTGGCCGTCGACCTCGGCGT
GCACCCCGAGGCCCTGCGCGGCTGGATCCGCCAGGCCGAGGCGGACGCCGGCGAACGCGACGACCGTCTCACCACCGACG
AACGCGCCGAGCTCGCGGCCCTGCGCAAGGAGAACGCCCAGCTCAAGCGGGCCAACGACGTCCTGCGGACGGCCTCGGCT
TTTTTCGCGGCGCAACTCGACCCGACCCGGCCCAGGTGA

Protein sequence :
MRERAVRMYRTTEPKPQIKKLAVDLGVHPEALRGWIRQAEADAGERDDRLTTDERAELAALRKENAQLKRANDVLRTASA
FFAAQLDPTRPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-07 47
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 8e-08 47
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-07 47
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 8e-08 47
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 1e-07 47
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-07 46
unnamed AAF09023.1 unknown Not tested SHI-O Protein 1e-07 46
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-07 46
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 1e-07 46
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 1e-07 46
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 8e-08 46
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 8e-11 46
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 1e-07 46
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-08 46
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 8e-11 46
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 8e-11 46
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 8e-11 46
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 8e-07 45
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 9e-11 45
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-06 45
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 2e-06 45
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 9e-11 45
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 9e-11 45
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 9e-11 45
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 1e-10 45
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 2e-05 45
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-06 45
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 2e-09 44
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 2e-09 44
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 2e-09 44
tnp7109-26 YP_001800854.1 transposase for insertion sequence Not tested Not named Protein 6e-06 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAB_81311 YP_003493618.1 transposase VFG1717 Protein 3e-08 47
SCAB_81311 YP_003493618.1 transposase VFG0643 Protein 3e-08 46
SCAB_81311 YP_003493618.1 transposase VFG1603 Protein 3e-07 45
SCAB_81311 YP_003493618.1 transposase VFG0606 Protein 5e-07 45