Gene Information

Name : SCAB_50261 (SCAB_50261)
Accession : YP_003490614.1
Strain : Streptomyces scabiei 87.22
Genome accession: NC_013929
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 5600831 - 5601406 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGTGGCAACGTCTCGCTCACCAAGGAGGCTCCGGGCCTGACCGCCGTCACCGTGGGCCT
CGGCTGGGACGTCCGCACCACCACCGGCACGGACTTCGACCTCGACGCCTCCGCGATCGCGGTCAACACGCAGGGCAAGG
TCTACTCGGACGGTCACTTCGTCTTCTTCAACAACAAGCAGACCCCGGACCAGACCATCGTCCACACCGGCGACAACCGC
ACGGGCGAGGGCCAGGGCGACGACGAGGCGATCAACGTCAACCTGGCGGGCCTCCCCGCCGACATCGACAAGATCGTCTT
CCCGGTCTCCATCTACGACGCCGAGAACCGCTCGCAGAACTTCGGCCAGGTCCGCAACGCCTACATCCGCATCGTCAACC
AGGCCGGCGGCGCCGAGATCGCCCGCTACGACCTCTCCGAGGACGCCGCCACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGTTACGCCTCGGGCCTCGTCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNTQGKVYSDGHFVFFNNKQTPDQTIVHTGDNR
TGEGQGDDEAINVNLAGLPADIDKIVFPVSIYDAENRSQNFGQVRNAYIRIVNQAGGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLVGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-59 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-59 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-58 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-58 59
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 9e-30 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAB_50261 YP_003490614.1 stress protein BAC0390 Protein 7e-59 62
SCAB_50261 YP_003490614.1 stress protein BAC0389 Protein 1e-57 59