Gene Information

Name : SCAB_28441 (SCAB_28441)
Accession : YP_003488502.1
Strain : Streptomyces scabiei 87.22
Genome accession: NC_013929
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3245401 - 3246069 bp
Length : 669 bp
Strand : -
Note : cluster 0594 with SCAB2741

DNA sequence :
ATGCGCCTGTTGATCGTGGAAGATGAGAAGCGGCTCGCGGTGTCGCTGGCCAAGGGGCTGACGGCCGAGGGATACGCCGT
GGACGTCGTCCACGACGGCGTCGAGGGCCTGCACCGCGCGAGCGAGGGGGCGTACGACCTCGTGATCCTCGACATCATGC
TGCCCGGCATGAACGGCTACCGCGTGTGCGCCGCCCTGCGCGCCGCCGGCCACGACGTGCCGATCCTCATGCTCACCGCG
AAGGACGGCGAGTACGACGAGGCGGAGGGCCTCGACACGGGCGCCGACGACTATCTGACCAAGCCGTTCTCCTACGTCGT
CCTCGTGGCCCGGGTGAAGGCGCTGCTGCGGCGGCGCCACGCCTCGGGCGGCGCCTCGCCCGTGCACGAGGTGGGGGAGC
TGAGGCTCGACACCGCCGCCCGCCGCGTGTTCCTCACCGAGGACGAGATCTCCCTGACCACCAAGGAGTTCTCCGTCCTG
GAGCAGCTGGTGCTCAGAGCCGGTGAGGTCGTCTCCAAGGCGGAGATCCTGGAGCACGTCTGGGACTTCGCCTACGACGG
CGACCCGAACATCGTCGAGGTCTACATCAGCACCCTGCGCCGCAAGCTCGGCCCCACGCTCATCAAGACCGTGCGCGGCG
CCGGCTACCGACTGGAGGGCCGCCCGTGA

Protein sequence :
MRLLIVEDEKRLAVSLAKGLTAEGYAVDVVHDGVEGLHRASEGAYDLVILDIMLPGMNGYRVCAALRAAGHDVPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLVARVKALLRRRHASGGASPVHEVGELRLDTAARRVFLTEDEISLTTKEFSVL
EQLVLRAGEVVSKAEILEHVWDFAYDGDPNIVEVYISTLRRKLGPTLIKTVRGAGYRLEGRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-32 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-31 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAB_28441 YP_003488502.1 two-component system response regulator BAC0197 Protein 1e-36 47
SCAB_28441 YP_003488502.1 two-component system response regulator U82965.2.orf14.gene. Protein 2e-27 47
SCAB_28441 YP_003488502.1 two-component system response regulator BAC0111 Protein 9e-37 46
SCAB_28441 YP_003488502.1 two-component system response regulator Y16952.3.orf35.gene. Protein 2e-26 45
SCAB_28441 YP_003488502.1 two-component system response regulator BAC0083 Protein 3e-36 45
SCAB_28441 YP_003488502.1 two-component system response regulator BAC0125 Protein 6e-37 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-35 44
SCAB_28441 YP_003488502.1 two-component system response regulator BAC0638 Protein 2e-31 44
SCAB_28441 YP_003488502.1 two-component system response regulator BAC0308 Protein 2e-38 43
SCAB_28441 YP_003488502.1 two-component system response regulator BAC0347 Protein 6e-30 43
SCAB_28441 YP_003488502.1 two-component system response regulator FJ349556.1.orf0.gene Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAB_28441 YP_003488502.1 two-component system response regulator VFG0596 Protein 1e-32 44
SCAB_28441 YP_003488502.1 two-component system response regulator VFG1389 Protein 2e-31 44
SCAB_28441 YP_003488502.1 two-component system response regulator VFG1390 Protein 1e-37 43