Gene Information

Name : SCAB_2741 (SCAB_2741)
Accession : YP_003486056.1
Strain : Streptomyces scabiei 87.22
Genome accession: NC_013929
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 293268 - 293957 bp
Length : 690 bp
Strand : -
Note : cluster 0594 with SCAB28441

DNA sequence :
ATGGCGGAAACTGAACGGATGCGCCTGCTTCTGGTCGAGGACGAACTACGACTCGCCGACGTCATCAAATCGGGACTGGT
GGACAAGGGTTTCGCCGTGGACGTGGTCGGCGACGGCAGTGAGGCCGTCTGGATGGCCGGTGAGCACCGGTACGACGCGA
TCGTGCTGGACGTGATGCTGCCGGGCCTCAACGGCTTCGCCGTGTGCCGGAAGTTGCGCGAGTCCGGCAACTGGACGCCG
ATCATGATGCTGACCGCTATGGACGGTGAACTCGACGAGGTCCAGTCGCTGGACAGTGGCGCGGACGACTACCTGGCCAA
ACCGTTCTCCTTCGCGGTGCTGCTGGCGCGGCTGCGGGCCCTCGTCCGCCGCGGGGCTCAGGAACGGCCCGCCGTCATCG
AGGTGGGGGATCTGCAGGTGGACCCGGCGGCGGCGTGCGCCCGGCGCGGCGGCGTGCACATCGCGCTCACTCCCAAGGAG
TTCGCGGTGCTGCACCTGCTGGCCCGCAGGGCCGGCCAAGTGGTCACCAAGACGGAACTGCTCCAGCACGCCTGGGACTT
CGCCTTCGAGGGCGATCCCAACATCGTCGAGGTGTACGTCAGTGCCCTGCGCCGCAAGATCGACGCACCGTTCGCGGTCC
GCACCCTGACGACGGTGCGAGGCAGCGGCTACCTTCTGGAGCGTCCGTGA

Protein sequence :
MAETERMRLLLVEDELRLADVIKSGLVDKGFAVDVVGDGSEAVWMAGEHRYDAIVLDVMLPGLNGFAVCRKLRESGNWTP
IMMLTAMDGELDEVQSLDSGADDYLAKPFSFAVLLARLRALVRRGAQERPAVIEVGDLQVDPAAACARRGGVHIALTPKE
FAVLHLLARRAGQVVTKTELLQHAWDFAFEGDPNIVEVYVSALRRKIDAPFAVRTLTTVRGSGYLLERP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAB_2741 YP_003486056.1 two-component system response regulator BAC0083 Protein 3e-38 48
SCAB_2741 YP_003486056.1 two-component system response regulator BAC0638 Protein 9e-29 45
SCAB_2741 YP_003486056.1 two-component system response regulator BAC0125 Protein 2e-40 43
SCAB_2741 YP_003486056.1 two-component system response regulator Y16952.3.orf35.gene. Protein 1e-25 43
SCAB_2741 YP_003486056.1 two-component system response regulator BAC0197 Protein 8e-34 43
SCAB_2741 YP_003486056.1 two-component system response regulator U82965.2.orf14.gene. Protein 8e-26 43
SCAB_2741 YP_003486056.1 two-component system response regulator BAC0308 Protein 7e-35 42
SCAB_2741 YP_003486056.1 two-component system response regulator AE000516.2.gene3505. Protein 9e-34 42
SCAB_2741 YP_003486056.1 two-component system response regulator NC_002516.2.879194.p Protein 5e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAB_2741 YP_003486056.1 two-component system response regulator VFG1390 Protein 1e-35 44
SCAB_2741 YP_003486056.1 two-component system response regulator VFG0596 Protein 2e-34 42
SCAB_2741 YP_003486056.1 two-component system response regulator VFG1389 Protein 1e-30 41