Gene Information

Name : Thit_0454 (Thit_0454)
Accession : YP_003476323.1
Strain : Thermoanaerobacter italicus Ab9
Genome accession: NC_013921
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 499845 - 500522 bp
Length : 678 bp
Strand : +
Note : KEGG: tpd:Teth39_1796 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGAAAGATTGTTGATTATAGATGATGAAGAGATGTTTGTAAAAGGTTTAAAACTTTCTTTAGAAGAAGAAGGCTTTGA
AGTTGATACTGCTTACGACGGAGAAGAAGGTCTTGACAAGGTTCGTTTGGGAAATTATGACCTAGTAATTTTAGATATTA
TGCTTCCTAAGTTAGATGGTTTTTCTGTGTGTAGAGAAATAAGAACTTTTTCAAATATACCAATAATTATGCTTACTGCA
AGGGGAGAGGATGTTGACAGAATTGTGGGAATAGAAATAGGAGCCGATGATTATTTGGCGAAGCCTTTTAACACGAGAGA
ACTTATTGCGAGGATAAGAGCGCTTTTAAGAAGAGCTACAAATCCTTATACTAAGAAAAAAGACGAAATAAAAAGGGGAG
AACTTTATATAAGTATTCCCGAAAGGGCAGTTTACAAAAGAGGAAAGAGAATTGAGCTTACCAATAAAGAATTTGAAATT
TTAGTGTTGTTAGCATCTAATCCAGGAAAGGTTTATACAAAAGATAAATTGCTAGACTTGGTATGGGGATTTGATTTTTA
CGGTGATACAAATACTGTTACAGTACATGTAAGAAAACTTAGAGAGAAAATTGAAGATGACCCTGCAAATCCTCAATATA
TTTTCACCAAATGGGGTGCAGGATACTATATGAAGTAA

Protein sequence :
MERLLIIDDEEMFVKGLKLSLEEEGFEVDTAYDGEEGLDKVRLGNYDLVILDIMLPKLDGFSVCREIRTFSNIPIIMLTA
RGEDVDRIVGIEIGADDYLAKPFNTRELIARIRALLRRATNPYTKKKDEIKRGELYISIPERAVYKRGKRIELTNKEFEI
LVLLASNPGKVYTKDKLLDLVWGFDFYGDTNTVTVHVRKLREKIEDDPANPQYIFTKWGAGYYMK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 6e-37 47
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-42 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-43 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-43 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-43 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-43 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-43 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-43 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-43 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-43 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-43 46
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-44 44
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-37 44
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator BAC0083 Protein 7e-29 44
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-32 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-35 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator BAC0638 Protein 7e-25 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 4e-34 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-40 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-30 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-30 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-30 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-30 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-30 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-30 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-30 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-30 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-32 42
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 5e-31 42
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 2e-33 42
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-35 42
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-33 41
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-33 41
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-30 43
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-29 42
Thit_0454 YP_003476323.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-33 41