Gene Information

Name : Thit_2312 (Thit_2312)
Accession : YP_003478080.1
Strain : Thermoanaerobacter italicus Ab9
Genome accession: NC_013921
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2363076 - 2363771 bp
Length : 696 bp
Strand : -
Note : KEGG: tte:TTE2689 response regulator; PFAM: response regulator receiver; transcriptional regulator; SMART: response regulator receiver; transcriptional regulator

DNA sequence :
ATGACTCATAGAATACTTATAGTTGATGATGAAAAGCCAATAGTTGAGATAATCAAATACAACCTGGAAAAAGAAGGATA
CATAACGTATGAAGCTTATGATGGAGAAGAGGCTTTAAAAATAGCAAAAGAACAAAATCCAGATTTAATAATACTTGATG
TGATGTTGCCTAAATTAGACGGTTTTTCAGTTCTAAGAACTTTAAGGCAATCAATGACCATACCTATTTTGATGCTAACG
GCCAAAGAGGAAGAAGTAGACAAAGTACTGGGGTTGGAATTGGGAGCCGATGATTACATAACAAAACCTTTTTCTATAAG
AGAACTTATAGCAAGAGTAAAGGCTAATTTAAGGAGAATTAGTTTAAACGGAAATGAGTCTGGTAATGTCCTTTGCGTAA
AAAATTTAAAAATTGACATGTCAAAGTATAAAGTAGAAAAAAACAATAAAGAAGTAGAACTCACCTCTAGAGAATTTGAA
CTTTTAAAATTTCTCGTTTTAAACAAAGGACTTATTTTTTCTCGTGAAATGCTATTGGAAAAAGTATGGGGTTATGAATA
TCTGGGTGATATTAGAACTGTAGATGTCACCATAAGAAGACTGAGAGAAAAAATAGAAGATGACCCCAGTAACCCCAAGC
TTATTCACACAAAAAGAGGGGTTGGTTACTATTTTAGCGATGAAAGGCAGATTTAA

Protein sequence :
MTHRILIVDDEKPIVEIIKYNLEKEGYITYEAYDGEEALKIAKEQNPDLIILDVMLPKLDGFSVLRTLRQSMTIPILMLT
AKEEEVDKVLGLELGADDYITKPFSIRELIARVKANLRRISLNGNESGNVLCVKNLKIDMSKYKVEKNNKEVELTSREFE
LLKFLVLNKGLIFSREMLLEKVWGYEYLGDIRTVDVTIRRLREKIEDDPSNPKLIHTKRGVGYYFSDERQI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-34 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-36 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-36 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-55 56
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-50 52
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-47 49
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-42 48
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 8e-38 46
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 6e-39 46
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-40 46
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-44 45
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 8e-38 45
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 1e-38 45
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 8e-38 45
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-36 45
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-30 44
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-36 44
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-33 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-33 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-33 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-33 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-33 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-33 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-33 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-33 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-26 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator BAC0308 Protein 4e-34 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 2e-35 42
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-36 42
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 9e-36 42
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 8e-37 42
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 9e-37 42
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-30 42
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-30 42
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-28 42
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-32 41
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-29 41
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-29 41
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-33 45
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-34 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-37 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-40 43
Thit_2312 YP_003478080.1 winged helix family two component transcriptional regulator VFG1563 Protein 9e-37 42