Gene Information

Name : Thit_1657 (Thit_1657)
Accession : YP_003477469.1
Strain : Thermoanaerobacter italicus Ab9
Genome accession: NC_013921
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1671785 - 1672009 bp
Length : 225 bp
Strand : -
Note : KEGG: tte:TTE2466 copper chaperone; TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein

DNA sequence : 
ATGGGCTGGTTTGGACCTAAAGGTGAAACTATTATCATAAATGTTAAGGGGATGACATGTAACCATTGCAAAATGTCTGT
CGAAAGTGCACTAAAAAAATTAAATGGTGTATCAAAAGCTGTTGTTGACCTTGACAAAGGAAATGTTACGGTAACTTATG
ATCCTTCCAAAGTTTCTATAGATGATATGAAAAAAGCAATTATTGATACAGGATATGAAGTGTAA

Protein sequence : 
MGWFGPKGETIIINVKGMTCNHCKMSVESALKKLNGVSKAVVDLDKGNVTVTYDPSKVSIDDMKKAIIDTGYEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 8e-10 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 8e-10 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 8e-10 43
merP AGK07023.1 MerP Not tested SGI1 Protein 8e-10 43
merP AGK07081.1 MerP Not tested SGI1 Protein 8e-10 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-09 43
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-09 42
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-09 42
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 7e-10 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thit_1657 YP_003477469.1 copper ion binding protein BAC0634 Protein 1e-07 46