Gene Information

Name : SLGD_02565 (SLGD_02565)
Accession : YP_003472755.1
Strain : Staphylococcus lugdunensis HKU09-01
Genome accession: NC_013893
Putative virulence/resistance : Virulence
Product : two-component response regulator SA14-24
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2647433 - 2648134 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
ATGGCAAGAAAAGTTGTTGTAGTTGATGATGAAAAACCAATTGCTGATATTTTAGAATTTAATCTAAAAAAAGAAGGATA
CGATGTTTATTGTGCCTATGATGGTAACGATGCCGTTGATTTAATTTATGAGGAAGAACCAGACATTGTGTTATTAGATA
TCATGTTACCTGGTCGAGACGGCATGGAAGTCTGCCGTGAAGTACGTAAAAAATTCGAAATGCCAATTATCATGCTAACG
GCAAAAGACTCTGAAATTGATAAAGTATTAGGCCTTGAATTAGGTGCTGACGATTACGTCACAAAACCTTTCAGTACACG
TGAATTAATTGCTCGAGTTAAAGCTAATTTACGTCGTCATTATTCACAACCTGCCCAAGAAGTGAATAACGCATCAAACG
AAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGCGGTGAAGATATTGAATTAACACAT
CGTGAATTTGAGTTGTTCCATTACTTATCTAAGCATATGGGTCAAGTGATGACACGTGAGCACTTGCTTCAAACTGTTTG
GGGCTATGACTATTTTGGAGATGTACGTACGGTTGACGTAACAATTCGTCGTTTACGCGAAAAAATCGAAGACGATCCAT
CACATCCAGAATATATCGTAACTAGAAGAGGCGTTGGATATTTCCTCCAACAACATGATTAG

Protein sequence :
MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKFEMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQEVNNASNEITIKDIVIYPDAYSIKKRGEDIELTH
REFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-37 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_012469.1.7685629. Protein 6e-71 63
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_002952.2859905.p0 Protein 1e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_002758.1121668.p0 Protein 2e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_007622.3794472.p0 Protein 1e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_009641.5332272.p0 Protein 2e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_013450.8614421.p0 Protein 2e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_007793.3914279.p0 Protein 2e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_003923.1003749.p0 Protein 1e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_002745.1124361.p0 Protein 2e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_009782.5559369.p0 Protein 2e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_002951.3237708.p0 Protein 2e-56 53
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 HE999704.1.gene2815. Protein 1e-51 49
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_012469.1.7686381. Protein 1e-46 47
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 AE016830.1.gene1681. Protein 7e-49 46
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 AE000516.2.gene3505. Protein 8e-42 46
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_005054.2598277.p0 Protein 3e-42 44
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 AF130997.1.orf0.gene Protein 2e-42 44
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_014475.1.orf0.gen Protein 3e-42 44
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 AM180355.1.gene1830. Protein 2e-44 44
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 FJ349556.1.orf0.gene Protein 7e-41 44
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 AF155139.2.orf0.gene Protein 3e-38 43
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_013450.8614146.p0 Protein 3e-36 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_002951.3238224.p0 Protein 3e-36 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_007793.3914065.p0 Protein 3e-36 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_002758.1121390.p0 Protein 3e-36 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_010079.5776364.p0 Protein 3e-36 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_002952.2859858.p0 Protein 3e-36 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_007622.3794948.p0 Protein 3e-36 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_003923.1003417.p0 Protein 3e-36 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 AE015929.1.gene1106. Protein 4e-31 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 HE999704.1.gene1528. Protein 3e-35 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 AF162694.1.orf4.gene Protein 1e-36 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 DQ212986.1.gene4.p01 Protein 5e-41 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 CP004022.1.gene3215. Protein 4e-37 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 CP001918.1.gene5135. Protein 1e-30 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 NC_002695.1.915041.p Protein 7e-34 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 CP000034.1.gene3834. Protein 7e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 VFG0596 Protein 5e-33 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 VFG1563 Protein 1e-37 41
SLGD_02565 YP_003472755.1 two-component response regulator SA14-24 VFG1702 Protein 1e-37 41