Gene Information

Name : XBJ1_2671 (XBJ1_2671)
Accession : YP_003468559.1
Strain : Xenorhabdus bovienii SS-2004
Genome accession: NC_013892
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 2625469 - 2625687 bp
Length : 219 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 7511582; Product type pr : regulator

DNA sequence : 
ATGTCAATAATTACCACATCTAAAGAAAGTCTTATTCGTTTATCAGAAGTTCAACGCAGAACAGGTTATAGCAAAGCGTG
GATCTATAGACTTATTGGAGAAGATAAATTCCCGAAACAAATTAAAATTGGCACTCGCTCAGTTGCTTTTCTTGAATCAG
AAGTTGATGGCTGGATAGATCAACGTATAGCTGAATCTCGCGGCGTGGTAGCACAATGA

Protein sequence : 
MSIITTSKESLIRLSEVQRRTGYSKAWIYRLIGEDKFPKQIKIGTRSVAFLESEVDGWIDQRIAESRGVVAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAA21398.1 - Not tested HPI Protein 2e-07 46
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 1e-07 46
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 2e-09 44
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 4e-09 44
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 4e-09 44
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 6e-09 43
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 9e-09 43
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 9e-05 41
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 9e-05 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XBJ1_2671 YP_003468559.1 hypothetical protein VFG1141 Protein 1e-09 44
XBJ1_2671 YP_003468559.1 hypothetical protein VFG1480 Protein 2e-09 43