Name : XBJ1_2671 (XBJ1_2671) Accession : YP_003468559.1 Strain : Xenorhabdus bovienii SS-2004 Genome accession: NC_013892 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 2625469 - 2625687 bp Length : 219 bp Strand : - Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 7511582; Product type pr : regulator DNA sequence : ATGTCAATAATTACCACATCTAAAGAAAGTCTTATTCGTTTATCAGAAGTTCAACGCAGAACAGGTTATAGCAAAGCGTG GATCTATAGACTTATTGGAGAAGATAAATTCCCGAAACAAATTAAAATTGGCACTCGCTCAGTTGCTTTTCTTGAATCAG AAGTTGATGGCTGGATAGATCAACGTATAGCTGAATCTCGCGGCGTGGTAGCACAATGA Protein sequence : MSIITTSKESLIRLSEVQRRTGYSKAWIYRLIGEDKFPKQIKIGTRSVAFLESEVDGWIDQRIAESRGVVAQ |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 2e-07 | 46 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 1e-07 | 46 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 44 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 44 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 44 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 9e-09 | 43 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 6e-09 | 43 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 9e-05 | 41 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 9e-05 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
XBJ1_2671 | YP_003468559.1 | hypothetical protein | VFG1141 | Protein | 1e-09 | 44 |
XBJ1_2671 | YP_003468559.1 | hypothetical protein | VFG1480 | Protein | 2e-09 | 43 |