Gene Information

Name : XBJ1_1837 (XBJ1_1837)
Accession : YP_003467743.1
Strain : Xenorhabdus bovienii SS-2004
Genome accession: NC_013892
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1796862 - 1797182 bp
Length : 321 bp
Strand : -
Note : Evidence 4 : Homologs of previously reported genes of unknown function; PubMedId : 17513477

DNA sequence :
ATGCAAACCTCAACTGTACCGGCCACGGTGCCGGTTTCATCACGCCTGTCTCCCGTCCAAGTGTGGCAACAACTGTTAAC
GTATCTACTGGAACACCATTACGGCCTCACACTCAACGACACGCCATTCCACGATGATTCAGCCATCCAGGAACATATCG
AGGCGGGTATCACTCTTGCTGATGCGGTGAATTTTCTCGTGGAACGTTATGAACTGGTACGCATCGACCGCAAGGGATTC
ACCTGGCAGGAACAGACGCCGTTCCTGACCGCCGCCGATATTCTCAGAGCCAGGCGAGCAACGGGCTTAATAAATACCTG
A

Protein sequence :
MQTSTVPATVPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDSAIQEHIEAGITLADAVNFLVERYELVRIDRKGF
TWQEQTPFLTAADILRARRATGLINT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 8e-26 64
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 5e-25 63
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-25 63
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 5e-25 63
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 5e-25 63
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 5e-25 63
unnamed AAL57575.1 unknown Not tested LEE Protein 2e-25 63
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 1e-24 62
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 1e-24 62
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 1e-24 62
unnamed AAL08478.1 unknown Not tested SRL Protein 2e-24 62
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 5e-25 62
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 3e-25 62
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 5e-25 62
unnamed AAC31486.1 L0007 Not tested LEE Protein 3e-24 61
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 4e-24 61
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 3e-24 61
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 4e-24 61
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 7e-24 61
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 5e-24 61
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-24 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XBJ1_1837 YP_003467743.1 hypothetical protein VFG1682 Protein 3e-26 64
XBJ1_1837 YP_003467743.1 hypothetical protein VFG1620 Protein 2e-25 63
XBJ1_1837 YP_003467743.1 hypothetical protein VFG1530 Protein 5e-25 62
XBJ1_1837 YP_003467743.1 hypothetical protein VFG1069 Protein 1e-24 62
XBJ1_1837 YP_003467743.1 hypothetical protein VFG0663 Protein 1e-25 62
XBJ1_1837 YP_003467743.1 hypothetical protein VFG0786 Protein 1e-24 61