Gene Information

Name : terD (XBJ1_1784)
Accession : YP_003467690.1
Strain : Xenorhabdus bovienii SS-2004
Genome accession: NC_013892
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1740834 - 1741412 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGGGTGTATCTCTTTCTAAAGGCGGTAACGTTTCTCTGAGCAAAGAAGCGCCAACAATGAAAAATGTTCTGATCGGTCT
TGGCTGGGATGCCCGTGCCACCGATGGACAAGATTTTGACCTTGATGCTTCTGCATTTCTGCTGTCAGCAAACGGCAAAG
TACGTGGTGATGCCGATTTCATTTTCTACAATAACCTGAAATCTGCTGATGGTTCCATCATGCACACTGGCGACAACCGT
ACCGGTGAGGGAGATGGCGATGATGAATCACTGAAAATCAAACTGGATCAGGTTCCGGCCGATGTGGAAAAAGTGGTGTT
TGTTGTGACTATCCATGACGCACAAACCCGTCATCAGAGCTTCGGACAAGTTTCCGGTGCCTTCATCCGATTGGTTAACG
ATGATACTCAGGTTGAAGTTGCCCGCTACGACCTGACTGAAGATGCTTCAACGGAAACGGCCATGCTGTTCGGTGAACTG
TATCGCCACAATACAGAGTGGAAATTCCGTGCAGTTGGTCAAGGTTATGCGGGTGGTCTGGCATCTGTTTGCGCTCAGTA
CGGCATTAACGCTTCCTGA

Protein sequence :
MGVSLSKGGNVSLSKEAPTMKNVLIGLGWDARATDGQDFDLDASAFLLSANGKVRGDADFIFYNNLKSADGSIMHTGDNR
TGEGDGDDESLKIKLDQVPADVEKVVFVVTIHDAQTRHQSFGQVSGAFIRLVNDDTQVEVARYDLTEDASTETAMLFGEL
YRHNTEWKFRAVGQGYAGGLASVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-80 89
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-80 89
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-79 88
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-66 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-59 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-57 65
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_003467690.1 tellurium resistance protein BAC0389 Protein 1e-79 90
terD YP_003467690.1 tellurium resistance protein BAC0390 Protein 5e-63 67