|
Name : alpA (XBJ1_1317) Accession : YP_003467237.1 Strain : Xenorhabdus bovienii SS-2004 Genome accession: NC_013892 Putative virulence/resistance : Virulence Product : CP4-57 prophage; transcriptional acitvator of a P4-like cryptic prophage Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1298764 - 1298970 bp Length : 207 bp Strand : + Note : - DNA sequence : ATGACAATGACAGCACCGAAAGAAAATCTTATTCGTTTGCCCGAAGTTCAGCGCAGAACGGGTTATAGCAAGGCGTGGAT CTACAAACTGATTAGTGATGGAGAATTCCCGAAACAAATCAAACTCGGCTCCCGTTCCATCGCGTTTATTGAATCAGAGA TTGATAACTGGATTGCGCAGCGGATCGCAGGATCACGAGCGGCATAG Protein sequence : MTMTAPKENLIRLPEVQRRTGYSKAWIYKLISDGEFPKQIKLGSRSIAFIESEIDNWIAQRIAGSRAA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 4e-08 | 47 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 3e-08 | 47 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-05 | 45 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-05 | 45 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-06 | 44 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-06 | 44 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-06 | 44 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 1e-05 | 42 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 9e-08 | 42 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 1e-07 | 42 |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 2e-07 | 42 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 3e-07 | 42 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-10 | 41 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-10 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| alpA | YP_003467237.1 | CP4-57 prophage; transcriptional acitvator of a P4-like cryptic prophage | VFG1480 | Protein | 1e-08 | 47 |
| alpA | YP_003467237.1 | CP4-57 prophage; transcriptional acitvator of a P4-like cryptic prophage | VFG1118 | Protein | 4e-07 | 44 |
| alpA | YP_003467237.1 | CP4-57 prophage; transcriptional acitvator of a P4-like cryptic prophage | VFG1141 | Protein | 8e-11 | 41 |
