Gene Information

Name : kdpE (XBJ1_1071)
Accession : YP_003467002.1
Strain : Xenorhabdus bovienii SS-2004
Genome accession: NC_013892
Putative virulence/resistance : Resistance
Product : response regulator in two-component regulatory system with KdpD, regulation of potassium translocation (OmpR family)
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1068058 - 1068723 bp
Length : 666 bp
Strand : +
Note : -

DNA sequence :
TTGATCGTTGAAGATGAAAAAGAGATCAGGCGTTTCGTCAGATTGGCTCTGGAAGGCGAAAACTGGCGAGTATTTGAATG
TGACACACTGAAACGAGGTTTAATTGAAGCAGCCACCCGCAAACCCGATTTGCTAATCCTTGACTTGGGATTGCCCGATG
GTAACGGCATTGATCTGATCCATGATATCCGCCAATGGAGTAGCATTCCAATCATTGTGCTTTCCGCACGCAATAATGAG
CAGGATAAAGTCGCGGCGCTGGATAGCGGTGCTGACGACTATCTGAGCAAGCCTTTTGGTATCAACGAGCTGCTTGCCAG
AGTCAGAGTTGCCCTGCGTCGCGCCACCAAAGCCAATCAGCCCGATCCGATGATTCATTTTGCCGATATCAGTGTTGACT
TAATCAATCGTCGGGTCTTAAAAAGCCAGAAGGAGCTTCATCTTACGCCGACGGAATATCGTCTGCTGACCGAATTGCTG
ACCAACAGCGGCAAGGTGCTGACCCAACGCTATTTGCTCAATCACGTCTGGGGGCCACATTATATCGAGCATAACCATTA
CCTGCGGATATATATGGGGCATCTGCGGCAAAAACTGGAAGAAGACCCTGCCCGTCCCAAGCATTTACTGACAGAGACTG
GCGTAGGTTATCGATTTATGCCCTGA

Protein sequence :
MIVEDEKEIRRFVRLALEGENWRVFECDTLKRGLIEAATRKPDLLILDLGLPDGNGIDLIHDIRQWSSIPIIVLSARNNE
QDKVAALDSGADDYLSKPFGINELLARVRVALRRATKANQPDPMIHFADISVDLINRRVLKSQKELHLTPTEYRLLTELL
TNSGKVLTQRYLLNHVWGPHYIEHNHYLRIYMGHLRQKLEEDPARPKHLLTETGVGYRFMP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SH0031 YP_251946.1 hypothetical protein Not tested SCCmec Protein 2e-19 42
kdpE YP_039536.1 response regulator protein Not tested Type-II SCCmec Protein 7e-19 41
kdpE NP_370594.1 transcriptional regulator kdpE Not tested Type-II SCCmec Protein 7e-19 41
kdpE NP_373306.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-19 41
kdeP YP_190033.1 DNA-binding response regulator KdeP Not tested Type-II SCCmec Protein 7e-19 41
kdpE BAA82188.1 KDP operon transcriptional regulatory protein KdpE Not tested Type-II SCCmec Protein 5e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
kdpE YP_003467002.1 response regulator in two-component regulatory system with KdpD, regulation of potassium translocation (OmpR family) NC_007793.3914065.p0 Protein 5e-14 42
kdpE YP_003467002.1 response regulator in two-component regulatory system with KdpD, regulation of potassium translocation (OmpR family) NC_002758.1121390.p0 Protein 5e-14 42
kdpE YP_003467002.1 response regulator in two-component regulatory system with KdpD, regulation of potassium translocation (OmpR family) NC_010079.5776364.p0 Protein 5e-14 42
kdpE YP_003467002.1 response regulator in two-component regulatory system with KdpD, regulation of potassium translocation (OmpR family) NC_002952.2859858.p0 Protein 5e-14 42
kdpE YP_003467002.1 response regulator in two-component regulatory system with KdpD, regulation of potassium translocation (OmpR family) NC_007622.3794948.p0 Protein 5e-14 42
kdpE YP_003467002.1 response regulator in two-component regulatory system with KdpD, regulation of potassium translocation (OmpR family) NC_003923.1003417.p0 Protein 5e-14 42
kdpE YP_003467002.1 response regulator in two-component regulatory system with KdpD, regulation of potassium translocation (OmpR family) NC_013450.8614146.p0 Protein 5e-14 42
kdpE YP_003467002.1 response regulator in two-component regulatory system with KdpD, regulation of potassium translocation (OmpR family) NC_002951.3238224.p0 Protein 5e-14 42