Name : lse_1832 (lse_1832) Accession : YP_003465067.1 Strain : Listeria seeligeri SLCC3954 Genome accession: NC_013891 Putative virulence/resistance : Resistance Product : heavy metal-binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1886804 - 1887010 bp Length : 207 bp Strand : - Note : - DNA sequence : ATGGAAAAATTAACTTTGAAAATTGAAGGAATGACTTGTGGGCACTGCGAGGCAAGAGTTACCAAGGCGCTTGCAGAAGT AGACGGGGTGACAAACGCCAAAGTATCCCTAGAAGAAGGAACTGCAACAGTTGAATTTGAAACAGGAAAAGTAACAGAAG ATAGTTTGATTGATGCAGTGGAAGATGCAGGATATGAAGTAGCATAA Protein sequence : MEKLTLKIEGMTCGHCEARVTKALAEVDGVTNAKVSLEEGTATVEFETGKVTEDSLIDAVEDAGYEVA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 9e-09 | 41 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 9e-09 | 41 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 9e-09 | 41 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 4e-09 | 41 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 1e-08 | 41 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 5e-09 | 41 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 9e-09 | 41 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 9e-09 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
lse_1832 | YP_003465067.1 | heavy metal-binding protein | BAC0674 | Protein | 5e-07 | 41 |
lse_1832 | YP_003465067.1 | heavy metal-binding protein | BAC0231 | Protein | 1e-09 | 41 |