Gene Information

Name : lse_1832 (lse_1832)
Accession : YP_003465067.1
Strain : Listeria seeligeri SLCC3954
Genome accession: NC_013891
Putative virulence/resistance : Resistance
Product : heavy metal-binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1886804 - 1887010 bp
Length : 207 bp
Strand : -
Note : -

DNA sequence :
ATGGAAAAATTAACTTTGAAAATTGAAGGAATGACTTGTGGGCACTGCGAGGCAAGAGTTACCAAGGCGCTTGCAGAAGT
AGACGGGGTGACAAACGCCAAAGTATCCCTAGAAGAAGGAACTGCAACAGTTGAATTTGAAACAGGAAAAGTAACAGAAG
ATAGTTTGATTGATGCAGTGGAAGATGCAGGATATGAAGTAGCATAA

Protein sequence :
MEKLTLKIEGMTCGHCEARVTKALAEVDGVTNAKVSLEEGTATVEFETGKVTEDSLIDAVEDAGYEVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 9e-09 41
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 9e-09 41
merP AFG30122.1 MerP Not tested PAGI-2 Protein 9e-09 41
merP AGK07023.1 MerP Not tested SGI1 Protein 9e-09 41
merP AGK07081.1 MerP Not tested SGI1 Protein 9e-09 41
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 4e-09 41
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-08 41
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 5e-09 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lse_1832 YP_003465067.1 heavy metal-binding protein BAC0674 Protein 5e-07 41
lse_1832 YP_003465067.1 heavy metal-binding protein BAC0231 Protein 1e-09 41