Gene Information

Name : AZL_c03880 (AZL_c03880)
Accession : YP_003452225.1
Strain :
Genome accession: NC_013857
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 470682 - 471029 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
ATGATCTCGGTTCCCGCCGGGGTGCGGGTCTATCTGGCGATGGGCGCCACCGACATGCGCAAGGGCATGGACGGGTTGGC
CATGCTCGCCCAGCAGGTCCTTCAGCAGGACCCGTTCGCCGGCCATTTGTTTGTTTTCCGGGGTCGGCAAGGTCATCTGG
TGAAGGTTCTTTACTGGGATGGCCAGGGCTTCTGCCTGTTCACCAAGCGCCTGGAGAAGGGGCGCTTCGTGTGGCCGATC
AGCCGCGAGGGCGTGGCGGTGCTCACTCCGGCCCAGTTGGCGATGCTCATCGAGGGCATGGATTGGCGCGCCCCGCAGCG
CACATGGCGCCCGGAGATGGCGGGGTGA

Protein sequence :
MISVPAGVRVYLAMGATDMRKGMDGLAMLAQQVLQQDPFAGHLFVFRGRQGHLVKVLYWDGQGFCLFTKRLEKGRFVWPI
SREGVAVLTPAQLAMLIEGMDWRAPQRTWRPEMAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-31 63
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-31 63
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 8e-31 62
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-27 58
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-27 58
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-28 57
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-28 57
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-27 57
unnamed AAC31493.1 L0014 Not tested LEE Protein 5e-27 57
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 8e-27 57
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 5e-27 57
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 8e-27 57
unnamed AAL99258.1 unknown Not tested LEE Protein 5e-27 57
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 8e-27 57
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 5e-27 57
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 5e-26 57
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 5e-26 57
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 8e-28 57
unnamed AAL08461.1 unknown Not tested SRL Protein 9e-27 56
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-28 53
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 5e-28 53
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 5e-28 53
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-27 53
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-27 53
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-19 52
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 1e-14 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZL_c03880 YP_003452225.1 transposase VFG1665 Protein 3e-31 62
AZL_c03880 YP_003452225.1 transposase VFG1698 Protein 4e-28 58
AZL_c03880 YP_003452225.1 transposase VFG1709 Protein 2e-27 57
AZL_c03880 YP_003452225.1 transposase VFG0792 Protein 2e-27 57
AZL_c03880 YP_003452225.1 transposase VFG1052 Protein 4e-27 56
AZL_c03880 YP_003452225.1 transposase VFG1737 Protein 2e-28 53
AZL_c03880 YP_003452225.1 transposase VFG1517 Protein 2e-19 52