Gene Information

Name : AZL_000280 (AZL_000280)
Accession : YP_003447210.1
Strain : Azospirillum sp. B510
Genome accession: NC_013854
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 27867 - 28613 bp
Length : 747 bp
Strand : +
Note : -

DNA sequence :
ATGCCGGTTAACGTCGAGACGCGCGCCGTGAACGGAGCCACCATGAACGCGGCCCTGAAGCCGCTCGTCCTGATCGTCGA
GGACGAGGCCGATATCCTGACGCTGCTGAAGTACAACCTGGAAAAGGAAGGCTTCCGCGTCGCCACCGCCAGCGACGGCG
AGGAGGCCCTGCTGGCCGCCGGCGAACAGACGCCGCACATCGTCCTGTTGGACTGGATGCTGCCGCTGATGAGCGGGCTG
GAGGTCTGCCGCCAGCTGCGCCGCAACGCCAAGACCCGCGACATCCCGATCATCATGCTGACCGCCCGCGGCGAGGAGGG
CGACCGCGTGCGCGGCCTGAATTCCGGCGCCGACGACTACATCACCAAGCCCTTCTCGCCGACCGAGCTGGTGGCCCGCA
TGCGCGCGGTGCTGCGCCGCGCCTCCCCCGGCATGACCGACGAGGTGCTGACCTTCGCCGACGTGACGATGGATCTGGCC
GCGCACCGCGTCCGCCGCAACAGCCGCGACGTCCATCTCGGGCCGACGGAGTTCCGCCTGCTGCGCCATTTCATGCAGCA
TCCCGGCCGCGTCTTCTCCCGCGAACAGCTGCTCGATCTGGTGTGGGGGCACGATGTGTATGTCGAGCCGCGCACCGTCG
ACGTCCATATCCGCCGCCTGCGCAAGGCGATGAACGAGGAGGATGAGCTGGACCTGATCCGTACCGTGCGGTCGGCCGGC
TACGCGCTCGATACCAAGTCGATGTGA

Protein sequence :
MPVNVETRAVNGATMNAALKPLVLIVEDEADILTLLKYNLEKEGFRVATASDGEEALLAAGEQTPHIVLLDWMLPLMSGL
EVCRQLRRNAKTRDIPIIMLTARGEEGDRVRGLNSGADDYITKPFSPTELVARMRAVLRRASPGMTDEVLTFADVTMDLA
AHRVRRNSRDVHLGPTEFRLLRHFMQHPGRVFSREQLLDLVWGHDVYVEPRTVDVHIRRLRKAMNEEDELDLIRTVRSAG
YALDTKSM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-30 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZL_000280 YP_003447210.1 two-component response regulator AE000516.2.gene3505. Protein 4e-38 46
AZL_000280 YP_003447210.1 two-component response regulator NC_011595.7057856.p0 Protein 5e-30 42
AZL_000280 YP_003447210.1 two-component response regulator NC_010400.5986590.p0 Protein 2e-29 42
AZL_000280 YP_003447210.1 two-component response regulator NC_010410.6002989.p0 Protein 5e-30 42
AZL_000280 YP_003447210.1 two-component response regulator AE016830.1.gene1681. Protein 3e-33 42
AZL_000280 YP_003447210.1 two-component response regulator HE999704.1.gene2815. Protein 4e-34 42
AZL_000280 YP_003447210.1 two-component response regulator NC_003923.1003749.p0 Protein 9e-36 42
AZL_000280 YP_003447210.1 two-component response regulator CP000647.1.gene2531. Protein 6e-30 42
AZL_000280 YP_003447210.1 two-component response regulator AE015929.1.gene1106. Protein 6e-24 41
AZL_000280 YP_003447210.1 two-component response regulator NC_012469.1.7685629. Protein 4e-32 41
AZL_000280 YP_003447210.1 two-component response regulator NC_002952.2859905.p0 Protein 6e-36 41
AZL_000280 YP_003447210.1 two-component response regulator NC_009641.5332272.p0 Protein 8e-36 41
AZL_000280 YP_003447210.1 two-component response regulator NC_013450.8614421.p0 Protein 8e-36 41
AZL_000280 YP_003447210.1 two-component response regulator NC_007793.3914279.p0 Protein 8e-36 41
AZL_000280 YP_003447210.1 two-component response regulator NC_007622.3794472.p0 Protein 6e-36 41
AZL_000280 YP_003447210.1 two-component response regulator NC_002745.1124361.p0 Protein 8e-36 41
AZL_000280 YP_003447210.1 two-component response regulator NC_009782.5559369.p0 Protein 8e-36 41
AZL_000280 YP_003447210.1 two-component response regulator NC_002951.3237708.p0 Protein 8e-36 41
AZL_000280 YP_003447210.1 two-component response regulator NC_002758.1121668.p0 Protein 8e-36 41
AZL_000280 YP_003447210.1 two-component response regulator CP001918.1.gene3444. Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZL_000280 YP_003447210.1 two-component response regulator VFG1390 Protein 1e-31 42
AZL_000280 YP_003447210.1 two-component response regulator VFG1702 Protein 2e-30 42
AZL_000280 YP_003447210.1 two-component response regulator VFG1389 Protein 1e-27 42
AZL_000280 YP_003447210.1 two-component response regulator VFG1563 Protein 2e-29 41