Gene Information

Name : Alvin_0277 (Alvin_0277)
Accession : YP_003442272.1
Strain : Allochromatium vinosum DSM 180
Genome accession: NC_013851
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 331761 - 332435 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein; KEGG: maq:Maqu_3740 two component transcriptional regulator

DNA sequence :
ATGCACATTCTGCTGGTCGAGGACGATCCGCAAATGGCCGACTATCTGCGCAAGGCACTCATCGAGGCGGGTGCCGTGGT
CGATCGCGCGGCCGATGGACGCGAGGGCTTGCTGATGGCCGCCGGCAGCGACTATGACGTCCTCATCCTGGATCGTATGC
TGCCCGGACTCGACGGGCTGGCGATCGTGCGAACCCTTCGCGCCTCGGGCAATCGTACCCCGGTGCTGTTCCTGAGCGCG
CTCGGCGATGTCGACGATCGGGTCGAGGGGCTGCGCGCCGGGGGCGACGACTATCTCATCAAACCCTTTGCCTTCTCTGA
ACTCCAGGCGCGCGTCGAGGCGCTGCTGCGGCGCGGCGCGGCCGAGGCTCCCGAGACCCGTCTGCGCGTGGGCGATCTGG
AGATGGATCTGCTCAAGCGCGAGGTCACGCGCGCGGGTCAGTCCATCCAACTCCAGCCGCGCGAGTTCCGGCTCCTGGAG
TGCCTGATGCGCCACGCCGGACGGGTCGTCACCCGCACCATGCTGCTCGAACAGGTCTGGGACTATCACTTCGACCCCCA
GACCAACGTCATCGACGTCCACATCAGCCGCCTGCGCGGCAAGATCGACAAAGACTTCGATCCGCCGCTGTTGCAGACGG
TGCGCGGCGCCGGCTACCGGTTGCAGGCCGGGTGA

Protein sequence :
MHILLVEDDPQMADYLRKALIEAGAVVDRAADGREGLLMAAGSDYDVLILDRMLPGLDGLAIVRTLRASGNRTPVLFLSA
LGDVDDRVEGLRAGGDDYLIKPFAFSELQARVEALLRRGAAEAPETRLRVGDLEMDLLKREVTRAGQSIQLQPREFRLLE
CLMRHAGRVVTRTMLLEQVWDYHFDPQTNVIDVHISRLRGKIDKDFDPPLLQTVRGAGYRLQAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-47 50
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-46 49
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-55 54
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-57 54
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-54 53
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-51 53
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-53 51
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-51 51
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator BAC0308 Protein 4e-50 49
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-31 43
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-39 41
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-48 50
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-35 46
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-40 45
Alvin_0277 YP_003442272.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-33 41