Gene Information

Name : Alvin_2593 (Alvin_2593)
Accession : YP_003444535.1
Strain : Allochromatium vinosum DSM 180
Genome accession: NC_013851
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2924239 - 2924817 bp
Length : 579 bp
Strand : -
Note : PFAM: stress protein; KEGG: kpe:KPK_A0197 tellurium resistance protein TerE

DNA sequence :
ATGGCCATCAGCTTGCAAAAAGGCGGTAACGTCAGCCTGACCAAGACCGATCCGGGTCTGACCAATGTCCAGGTCGGACT
GGGCTGGGACGCGCGTTCCACCGACGGCGCCGCCTTCGATCTGGACGCCAGCGTGTTCCTGGTCGGTGACGACGGCAAGG
TGCTCTCGGACGGTCACTTCGTCTTCTACAACCAGAAGACCTCGCCCGATGGGGCCGTGATTCATGCCGGCGACAACACC
ACGGGCGCGGGCGAGGGCGACGACGAAGTCGTGACCATCAATCTGCCGGGCGTCGAGGCCGGGGTGAAGCGTGTCGTCTT
CGCCGTCACCATCCACGAGGCCGAGAGCCGCAAGCAGAATTTCGGCATGGTGCGCAATGCCTTCATGCGTGTGCTCAACA
AGGACAGCAACACCGAGCTGGCCCGCTTCGACCTCTCCGAGGACTACTCGATCGAGACGGCCATGATTTTTGGCGAGATC
TATCGCAACGGTGAGGAGTGGAAGTTCAAGGCCGTCGGCCAGGGCTTCGCCGGTGGTCTGGCCGCGCTGGCCAAGGATCA
CGGCGTCAACATCGGCTGA

Protein sequence :
MAISLQKGGNVSLTKTDPGLTNVQVGLGWDARSTDGAAFDLDASVFLVGDDGKVLSDGHFVFYNQKTSPDGAVIHAGDNT
TGAGEGDDEVVTINLPGVEAGVKRVVFAVTIHEAESRKQNFGMVRNAFMRVLNKDSNTELARFDLSEDYSIETAMIFGEI
YRNGEEWKFKAVGQGFAGGLAALAKDHGVNIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-55 72
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-55 72
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-55 72
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-55 68
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-50 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 59
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 59
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-50 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alvin_2593 YP_003444535.1 stress protein BAC0390 Protein 1e-58 75
Alvin_2593 YP_003444535.1 stress protein BAC0389 Protein 5e-50 59