Gene Information

Name : Alvin_0025 (Alvin_0025)
Accession : YP_003442029.1
Strain : Allochromatium vinosum DSM 180
Genome accession: NC_013851
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 24512 - 25189 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein; KEGG: mno:Mnod_6194 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGCCTGCTGTTGGTAGAAGACGACGACCAGGTCGCCGAGACGGTGACGGCCGGTCTGACGGCTGCCGGTTTCCTGGT
CGAGCGCGCGCGCGACGGGCGCGAGGCCTGGTTCATGGGCGACACCGAACCCTATGCCGCCGCCATCCTGGATCTCGGTC
TGCCGGGACTCGATGGGCTGTCGGTCCTGCGCCAGTGGCGCGCCGCTGGTCAGCGTCTGCCGGTGCTGATCCTGAGCGCG
CGCGGCGACTGGACCGAGCGTGTCGAGGGCATCGAGGCCGGCGCCGACGACTATCTGCCCAAGCCCTTCCGGTTCGAGGA
ACTGCTCGCGCGCGTGCGGGCGCTGATCCGCCGCGCCGCCGGTCAGCCGGCGCCCGTGCTCGTCCACGGCTCCTTCCGAC
TCGACACCCGGCGTCAGACTCTGAGCCGCGACGGGCTGCCCATCCATCTCTCGCCCCAGGAATACCGTCTGGTCAGCTAT
CTGATGCAGCAGGCCGGGCGCGTCGTCTCGCAACAGGAGCTGACCGAGCAGCTCTATGCCCAGGATTTCGAGCGCGACTC
CAACGCTGTGGAGGTGCTGGTCGGTCGCGTGCGGCGCAAACTGGGGGCCGAGCTGATCCAGACCCGGCGCGGTTTCGGCT
ATCTGATCGAGGCGGACGACGCCTCGCATGCCCCATGA

Protein sequence :
MRLLLVEDDDQVAETVTAGLTAAGFLVERARDGREAWFMGDTEPYAAAILDLGLPGLDGLSVLRQWRAAGQRLPVLILSA
RGDWTERVEGIEAGADDYLPKPFRFEELLARVRALIRRAAGQPAPVLVHGSFRLDTRRQTLSRDGLPIHLSPQEYRLVSY
LMQQAGRVVSQQELTEQLYAQDFERDSNAVEVLVGRVRRKLGAELIQTRRGFGYLIEADDASHAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-20 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-24 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 3e-30 45
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 2e-29 44
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator BAC0530 Protein 2e-29 44
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 2e-28 42
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 8e-29 42
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator BAC0487 Protein 3e-21 41
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-22 41
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 1e-27 41
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 1e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-20 43
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator VFG0475 Protein 7e-29 42
Alvin_0025 YP_003442029.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-24 41