Gene Information

Name : Alvin_0011 (Alvin_0011)
Accession : YP_003442015.1
Strain : Allochromatium vinosum DSM 180
Genome accession: NC_013851
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 11227 - 11886 bp
Length : 660 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein; KEGG: sbm:Shew185_0239 two component transcriptional regulator

DNA sequence : 
ATGCGCTTGTTACTGGTCGAAGACGATCCCGCACAGATCGCCGCCCTGTTGCCGGCTCTGAATGCTGCCGGCTTCGCGGT
CGATCAGGCGCAGGATGGTGCGATCGGCGAGCGCTTGGGCGAGACCGAACCCTATGACGTCATCGTGCTCGATCTCGGTT
TGCCCAAACGGCCCGGCCTGGAGGTGCTACGGCACTGGCGTGCCCGTGGTCTGAGCCTACCGGTCCTGATATTGACCGCG
CGCGATGCCTGGCCTGAGCGTGTCGACGGACTCAAGGCCGGCGCCGACGACTATCTGGGCAAACCCTTTCATGTCGAGGA
GCTGATCGCACGTCTCAATGCCCTCACACGCCGCGCGGCGGGCAACCTGCGCCCGGCGCTTGCCGTCGGCGGTCTGTCGC
TCGACGCGGATCGACAGCAGGTCATCTGCCCCGACGGCGAGGTTCGCGAACTGACCGGAACCGAGTTCCGGCTGTTGCGC
TATCTGATGCTCAATCCAGGGCGCATCCTGTCGAAGGCGCAACTCCTGGAGCACGTCTATGAGCTGGAGGCCGAGCGGGG
CGACAATCTGATCGAGGTCTACATACGGCGCCTGCGCGAGAAGATCGGTCGCGATCGCATCCAGACCCTGCGCGGTCAGG
GATACCTGTTGAAACGATGA

Protein sequence : 
MRLLLVEDDPAQIAALLPALNAAGFAVDQAQDGAIGERLGETEPYDVIVLDLGLPKRPGLEVLRHWRARGLSLPVLILTA
RDAWPERVDGLKAGADDYLGKPFHVEELIARLNALTRRAAGNLRPALAVGGLSLDADRQQVICPDGEVRELTGTEFRLLR
YLMLNPGRILSKAQLLEHVYELEAERGDNLIEVYIRRLREKIGRDRIQTLRGQGYLLKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-37 44
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator BAC0487 Protein 4e-36 44
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-31 43
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 4e-34 41
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 1e-34 41
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-30 41
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-24 41
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator BAC0530 Protein 4e-34 41
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator VFG0473 Protein 8e-37 43
Alvin_0011 YP_003442015.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-29 42