Gene Information

Name : BpOF4_20584 (BpOF4_20584)
Accession : YP_003429004.1
Strain :
Genome accession: NC_013792
Putative virulence/resistance : Resistance
Product : mercuric resistance operon regulatory protein MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 115508 - 115993 bp
Length : 486 bp
Strand : -
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
TTGAATATTGAACGAGAAAACATACATAATGAAGTTATCCTTGACCGTGTACTATGGTACGCGGTTTATTATATTCCTAG
AGGTGAAAAAATGAGTTATCGTATAAGTGCATTTGCAAAAAAGTGTGGAGTAAATAAAGAGACCATTAGATATTATGAAA
AAAAGAATTTATTACAAGAACCATTAAAAACAAATGCTGGTTATCGGATATATTCAGATGAAGATGTGAAGCGGGTAGGT
TTTATTAAAAGAATGCAAGAGCTTGGTTTTTCTTTAAGTGAAATTTTTACATTACTTGGGGTTGTAGATAAAGAAGTTCG
CTGTGAAGATATGTTTGAATTTGTATCTAAAAAAGAAGAGGAAGTTCAAAAACAAATAGAGGATTTAAAGCGAATTGAAA
CGATGTTAAAAGATTTAAAAAGGCGATGTCCAGATGAAAAACAATTACATGCCTGCCCAATAATTGAAACATTGATTGAG
CAGTAA

Protein sequence :
MNIERENIHNEVILDRVLWYAVYYIPRGEKMSYRISAFAKKCGVNKETIRYYEKKNLLQEPLKTNAGYRIYSDEDVKRVG
FIKRMQELGFSLSEIFTLLGVVDKEVRCEDMFEFVSKKEEEVQKQIEDLKRIETMLKDLKRRCPDEKQLHACPIIETLIE
Q

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 4e-33 54
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 3e-33 54
merR AGK07083.1 MerR Not tested SGI1 Protein 7e-21 44
merR AGK07025.1 MerR Not tested SGI1 Protein 7e-21 44
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-20 43
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-20 43
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-20 43
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-20 43
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-20 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-20 42
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BpOF4_20584 YP_003429004.1 mercuric resistance operon regulatory protein MerR BAC0682 Protein 6e-37 61
BpOF4_20584 YP_003429004.1 mercuric resistance operon regulatory protein MerR BAC0680 Protein 1e-33 53
BpOF4_20584 YP_003429004.1 mercuric resistance operon regulatory protein MerR BAC0688 Protein 2e-21 45
BpOF4_20584 YP_003429004.1 mercuric resistance operon regulatory protein MerR BAC0683 Protein 8e-21 43
BpOF4_20584 YP_003429004.1 mercuric resistance operon regulatory protein MerR BAC0684 Protein 8e-21 43
BpOF4_20584 YP_003429004.1 mercuric resistance operon regulatory protein MerR BAC0686 Protein 1e-20 42
BpOF4_20584 YP_003429004.1 mercuric resistance operon regulatory protein MerR BAC0232 Protein 2e-20 42
BpOF4_20584 YP_003429004.1 mercuric resistance operon regulatory protein MerR BAC0687 Protein 2e-20 42