Gene Information

Name : walR (BpOF4_07830)
Accession : YP_003426516.1
Strain : Bacillus pseudofirmus OF4
Genome accession: NC_013791
Putative virulence/resistance : Virulence
Product : two-component response regulator yycF
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3833705 - 3834415 bp
Length : 711 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGATAAGCGTATTCTCGTAGTAGATGATGAAAAACCAATCGCTGATATATTAAAGTTTAACTTAGAAAAAGAGGGCTT
TGAAGTATTTTGTGCTTATGATGGCAACGAAGCTGTTGAACAAGTAAAAAAAGAAGAGCCTGATCTCATTTTACTAGATA
TTATGTTACCTCATAAGGATGGGATGGAAGTATGCCGTGAAGTACGAAAAAGCTATGATATTCCGATTATTATGCTGACA
GCGAAAGATTCTGAGATTGATAAAGTCTTAGGACTTGAGCTTGGGGCGGATGATTATGTCACGAAGCCTTTTAGCACAAG
AGAATTGCTCGCACGTGTTAAAGCAAACTTACGCCGCAGAAAATCCGGTGCTGAAGAAGTGTCAACGCAAAAAGAATTAA
CGGTAGGAGACTTAACGATTTACCCGGATGCTTATCAAGTGAAGCGCCGCGGTGAGACAATTGAGTTGACACATAGAGAA
TTTGAGCTGATTCATTACTTAGCTAAACACCTAGGACAAGTGATGACGCGTGAGCATCTTCTGCAGGCTGTATGGGGCTA
TGATTATTTTGGTGATGTACGTACAGTCGATGTGACGGTTAGAAGACTTAGAGAAAAAGTTGAGGATAATCCAAGCTATC
CAAACTGGATCATAACACGACGCGGGGTAGGGTATTATTTATCATCGCCTGAAGATGTGGAGCAAGGTTAA

Protein sequence :
MDKRILVVDDEKPIADILKFNLEKEGFEVFCAYDGNEAVEQVKKEEPDLILLDIMLPHKDGMEVCREVRKSYDIPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRRKSGAEEVSTQKELTVGDLTIYPDAYQVKRRGETIELTHRE
FELIHYLAKHLGQVMTREHLLQAVWGYDYFGDVRTVDVTVRRLREKVEDNPSYPNWIITRRGVGYYLSSPEDVEQG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-25 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-33 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_003426516.1 two-component response regulator yycF NC_012469.1.7685629. Protein 4e-63 65
walR YP_003426516.1 two-component response regulator yycF NC_002952.2859905.p0 Protein 3e-54 54
walR YP_003426516.1 two-component response regulator yycF NC_003923.1003749.p0 Protein 3e-54 54
walR YP_003426516.1 two-component response regulator yycF NC_002758.1121668.p0 Protein 4e-54 54
walR YP_003426516.1 two-component response regulator yycF NC_007622.3794472.p0 Protein 3e-54 54
walR YP_003426516.1 two-component response regulator yycF NC_009641.5332272.p0 Protein 4e-54 54
walR YP_003426516.1 two-component response regulator yycF NC_013450.8614421.p0 Protein 4e-54 54
walR YP_003426516.1 two-component response regulator yycF NC_007793.3914279.p0 Protein 4e-54 54
walR YP_003426516.1 two-component response regulator yycF NC_002745.1124361.p0 Protein 4e-54 54
walR YP_003426516.1 two-component response regulator yycF NC_009782.5559369.p0 Protein 4e-54 54
walR YP_003426516.1 two-component response regulator yycF NC_002951.3237708.p0 Protein 4e-54 54
walR YP_003426516.1 two-component response regulator yycF HE999704.1.gene2815. Protein 2e-46 51
walR YP_003426516.1 two-component response regulator yycF NC_012469.1.7686381. Protein 7e-43 50
walR YP_003426516.1 two-component response regulator yycF AE000516.2.gene3505. Protein 2e-37 48
walR YP_003426516.1 two-component response regulator yycF HE999704.1.gene1528. Protein 3e-30 47
walR YP_003426516.1 two-component response regulator yycF AE016830.1.gene1681. Protein 2e-42 46
walR YP_003426516.1 two-component response regulator yycF FJ349556.1.orf0.gene Protein 6e-36 46
walR YP_003426516.1 two-component response regulator yycF AF155139.2.orf0.gene Protein 5e-34 45
walR YP_003426516.1 two-component response regulator yycF CP004022.1.gene3215. Protein 4e-36 44
walR YP_003426516.1 two-component response regulator yycF AF162694.1.orf4.gene Protein 1e-32 44
walR YP_003426516.1 two-component response regulator yycF BAC0596 Protein 4e-29 44
walR YP_003426516.1 two-component response regulator yycF CP000034.1.gene2186. Protein 2e-30 44
walR YP_003426516.1 two-component response regulator yycF CP001138.1.gene2239. Protein 4e-29 44
walR YP_003426516.1 two-component response regulator yycF NC_002695.1.916589.p Protein 2e-30 44
walR YP_003426516.1 two-component response regulator yycF BAC0039 Protein 2e-30 44
walR YP_003426516.1 two-component response regulator yycF EU250284.1.orf4.gene Protein 1e-34 43
walR YP_003426516.1 two-component response regulator yycF CP001918.1.gene5135. Protein 2e-29 43
walR YP_003426516.1 two-component response regulator yycF AM180355.1.gene1830. Protein 5e-37 43
walR YP_003426516.1 two-component response regulator yycF NC_002952.2859858.p0 Protein 3e-33 43
walR YP_003426516.1 two-component response regulator yycF NC_007622.3794948.p0 Protein 3e-33 43
walR YP_003426516.1 two-component response regulator yycF NC_003923.1003417.p0 Protein 3e-33 43
walR YP_003426516.1 two-component response regulator yycF NC_013450.8614146.p0 Protein 3e-33 43
walR YP_003426516.1 two-component response regulator yycF NC_002951.3238224.p0 Protein 3e-33 43
walR YP_003426516.1 two-component response regulator yycF NC_007793.3914065.p0 Protein 3e-33 43
walR YP_003426516.1 two-component response regulator yycF NC_002758.1121390.p0 Protein 3e-33 43
walR YP_003426516.1 two-component response regulator yycF NC_010079.5776364.p0 Protein 3e-33 43
walR YP_003426516.1 two-component response regulator yycF NC_002695.1.915041.p Protein 4e-33 42
walR YP_003426516.1 two-component response regulator yycF CP001138.1.gene4273. Protein 1e-33 42
walR YP_003426516.1 two-component response regulator yycF CP000647.1.gene4257. Protein 5e-34 42
walR YP_003426516.1 two-component response regulator yycF CP000034.1.gene3834. Protein 4e-33 42
walR YP_003426516.1 two-component response regulator yycF BAC0533 Protein 5e-34 42
walR YP_003426516.1 two-component response regulator yycF CP004022.1.gene1676. Protein 3e-29 42
walR YP_003426516.1 two-component response regulator yycF CP001918.1.gene3444. Protein 1e-29 42
walR YP_003426516.1 two-component response regulator yycF BAC0125 Protein 7e-26 41
walR YP_003426516.1 two-component response regulator yycF NC_005054.2598277.p0 Protein 7e-36 41
walR YP_003426516.1 two-component response regulator yycF NC_014475.1.orf0.gen Protein 7e-36 41
walR YP_003426516.1 two-component response regulator yycF CP000647.1.gene2531. Protein 9e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_003426516.1 two-component response regulator yycF VFG1389 Protein 2e-28 44
walR YP_003426516.1 two-component response regulator yycF VFG1390 Protein 2e-34 43
walR YP_003426516.1 two-component response regulator yycF VFG0596 Protein 6e-26 41
walR YP_003426516.1 two-component response regulator yycF VFG1563 Protein 5e-33 41
walR YP_003426516.1 two-component response regulator yycF VFG1702 Protein 1e-32 41