Gene Information

Name : lisR (LM5578_1518)
Accession : YP_003413628.1
Strain : Listeria monocytogenes 08-5578
Genome accession: NC_013766
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1471538 - 1472218 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGAATAGAATACTAATCGTAGAAGATGAAAAAAACTTAGCACGCTTTATTGAACTAGAACTCCAGCATGAAAATTATGA
AACAGCGGTTGCTAATGATGGACGCGCTGGACTCGAACTCGCACTTAATGAAGAATGGGATGCTATTTTACTCGATCTAA
TGTTGCCACATTTAAACGGGGTAGAAGTTTGTCGTCGTGTGCGCCAAGTGAAACAAACACCCATTATTATGATAACCGCA
CGTGACTCTGTTATCGATCGTGTATCCGGACTGGATCACGGAGCAGATGATTACATCGTCAAACCTTTCGCTATTGAAGA
ATTACTTGCGCGCCTTCGCTCGCTATTGCGTCGGGTGGAAAATGCAGAACAATCTGCTAAACAAACAACGCTACAGTATC
GTAATCTAATTGTTGAAAAGGAAAATCGCATTGTCAAACGCGACGAAGAAATCATTGACTTAACAAAACGAGAGTATGAA
CTTTTACTTACGTTAATGGAAAATGTTAATATCGTTCTTACGCGGGAAGTGTTACTCAATAAAGTATGGGGTTATGAAAC
AGAAGTAGAAACAAATGTAGTGGATGTGTACGTTCGTTACTTACGAAATAAAATTGATCATCCTGACGAAGAAAGTTATA
TTCAAACAGTTCGCGGGACAGGGTATGTGATGCGTACATGA

Protein sequence :
MNRILIVEDEKNLARFIELELQHENYETAVANDGRAGLELALNEEWDAILLDLMLPHLNGVEVCRRVRQVKQTPIIMITA
RDSVIDRVSGLDHGADDYIVKPFAIEELLARLRSLLRRVENAEQSAKQTTLQYRNLIVEKENRIVKRDEEIIDLTKREYE
LLLTLMENVNIVLTREVLLNKVWGYETEVETNVVDVYVRYLRNKIDHPDEESYIQTVRGTGYVMRT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lisR YP_003413628.1 two-component response regulator HE999704.1.gene1528. Protein 3e-94 100
lisR YP_003413628.1 two-component response regulator AE015929.1.gene1106. Protein 3e-47 56
lisR YP_003413628.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-49 55
lisR YP_003413628.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-49 55
lisR YP_003413628.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-49 55
lisR YP_003413628.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-49 55
lisR YP_003413628.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-49 55
lisR YP_003413628.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-49 55
lisR YP_003413628.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-49 55
lisR YP_003413628.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-49 55
lisR YP_003413628.1 two-component response regulator BAC0308 Protein 2e-31 43
lisR YP_003413628.1 two-component response regulator BAC0125 Protein 5e-31 42
lisR YP_003413628.1 two-component response regulator NC_012469.1.7685629. Protein 7e-37 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lisR YP_003413628.1 two-component response regulator VFG1390 Protein 6e-40 44
lisR YP_003413628.1 two-component response regulator VFG1389 Protein 5e-32 43
lisR YP_003413628.1 two-component response regulator VFG1563 Protein 2e-31 41
lisR YP_003413628.1 two-component response regulator VFG1702 Protein 1e-31 41