Gene Information

Name : Gobs_4693 (Gobs_4693)
Accession : YP_003411611.1
Strain : Geodermatophilus obscurus DSM 43160
Genome accession: NC_013757
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4908537 - 4909199 bp
Length : 663 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sen:SACE_0101 two component system response regulator

DNA sequence :
GTGAGCCGCGTGCTCATCGCCGAGGACGAGGCCCGCATCGCCGCCTTCGTGGAGAAGGGGCTGCGGGCCAACGGCTTCGC
CACGGCCGTCGTCGCCGACGGCCGCACCGCCCGGGCCGCCGCGGCCAGCGGCGACTTCGACCTGATGATCCTCGACATCG
GCCTGCCCGGCATGGACGGCTTCGAGGTGCTGCGGGCGCTGCGGGCCGACCGCGTGACCATCCCGGTCGTCATCCTCACC
GCACGGGACAGCGTCCAGGACACGGTGGCCGCGCTGGAGGGCGGAGCCGACGACTACATGCCCAAGCCGTTCCGCTTCGA
GGAGCTGCTGGCCCGAGTGCGGTTGCGGCTCTCCGGCGGCCGGCAGACCGAGACCACCGTGCTCACCTGCGGCGACCTGT
CGCTGGACCTGCGGACCCGGCGCGCGCAGGCGGGCAGCCGCACGGTCGCCCTGTCCGCTCGCGAGTTCGCCCTGGCCGAG
ACCTTCCTGCGCCACCCCGGTCAGGTGCTGGCCCGCGAGCAGCTGCTCAGCCACGTCTGGGGCTACGACTTCGACCCCGG
CTCCAACGTCGTCGACGTCTACGTCCGCTACCTGCGCCGCAAGCTCGGTGCCGACCGGATCGAGACGGTGCGGGGGATGG
GCTACCGCCTGGTCGCGGCCTGA

Protein sequence :
MSRVLIAEDEARIAAFVEKGLRANGFATAVVADGRTARAAAASGDFDLMILDIGLPGMDGFEVLRALRADRVTIPVVILT
ARDSVQDTVAALEGGADDYMPKPFRFEELLARVRLRLSGGRQTETTVLTCGDLSLDLRTRRAQAGSRTVALSAREFALAE
TFLRHPGQVLAREQLLSHVWGYDFDPGSNVVDVYVRYLRRKLGADRIETVRGMGYRLVAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-36 48
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-39 46
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-32 45
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator BAC0125 Protein 8e-36 44
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator BAC0308 Protein 8e-34 43
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 5e-26 43
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-28 42
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-33 41
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-33 41
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-33 41
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-33 41
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-30 41
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-33 41
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-33 41
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-33 41
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-33 41
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-35 47
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-34 43
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator VFG1386 Protein 7e-36 43
Gobs_4693 YP_003411611.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-32 42