Gene Information

Name : Gobs_4285 (Gobs_4285)
Accession : YP_003411218.1
Strain : Geodermatophilus obscurus DSM 43160
Genome accession: NC_013757
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4503368 - 4504084 bp
Length : 717 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sen:SACE_6447 two-component response regulator

DNA sequence :
ATGGTGGTCGTGCCACCCACCGCTCCCCAGAACGGGCCCTCTCGCGGCCGAGTCCTGGTCGTCGACGACGACGCCGCCCT
CGCCGAGATGCTCGGCATCGTGCTCCGGCGCGAGGGCTACGAACCCGCCTTCGTCTCCGACGGCAACCGCGCGGTGGGCG
CGTTCCAGCAGACCCGCCCCGACATCGTGCTGCTCGACCTGATGCTGCCCGGCCGCAACGGCCTGCAGATTTGCCAGGAC
ATCCGCACCCAGTCCACCGTCCCGATCGTCATGCTCACCGCCAAGGGCGACACCATCGACGTCGTCCAGGGGCTCGAGGC
CGGCGCGGACGACTACGTCACCAAGCCGTTCAAGCCGGTCGAGCTGGTGGCCCGGGTGCGTGCCCAGCTGCGCCGCGGGG
AGACCGGGCAGGCGGAGAACCTCTCGATCGGCGACGTGCAGATCGACGTCCCGGCGCACCAGGTCACCCGGGACGGCGTG
CCGATCGCGCTGACCCCGCTGGAGTTCGACCTGCTGGTCGCCCTGGCGCGCAAGCCGCGCCAGGTGTTCACCCGCGAGCT
GCTGCTCGAGCAGGTGTGGGGCTACCGGCACGCCGCGGACACCCGGCTGGTCAACGTCCACGTGCAGCGGCTGCGCGCGA
AGATCGAGCGGGACCCGGAGAAGCCGGAGATCGTGCTGACCGTGCGGGGAGTCGGCTACAAGGCCGGCCCGCCGTGA

Protein sequence :
MVVVPPTAPQNGPSRGRVLVVDDDAALAEMLGIVLRREGYEPAFVSDGNRAVGAFQQTRPDIVLLDLMLPGRNGLQICQD
IRTQSTVPIVMLTAKGDTIDVVQGLEAGADDYVTKPFKPVELVARVRAQLRRGETGQAENLSIGDVQIDVPAHQVTRDGV
PIALTPLEFDLLVALARKPRQVFTRELLLEQVWGYRHAADTRLVNVHVQRLRAKIERDPEKPEIVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-37 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-38 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-75 74
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-44 46
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-38 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-45 44
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-34 42
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 9e-41 42
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-37 42
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 5e-38 42
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-38 42
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator BAC0039 Protein 5e-38 42
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-39 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-39 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-39 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-39 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-39 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-39 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-39 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-39 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-41 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-35 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-42 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-38 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 4e-37 41
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator VFG1702 Protein 6e-38 43
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-32 43
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator VFG1390 Protein 8e-36 42
Gobs_4285 YP_003411218.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-38 42