Gene Information

Name : Gobs_2351 (Gobs_2351)
Accession : YP_003409398.1
Strain : Geodermatophilus obscurus DSM 43160
Genome accession: NC_013757
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2441675 - 2442370 bp
Length : 696 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: ace:Acel_1832 two component transcriptional regulator

DNA sequence :
GTGGGCAGTCCCGGGGGCGTGGCCCGGTCCGTGCTGATCATCGAGGACGACGACCGCATCCGGCGCGTCGTCTCGATCAC
CCTCCGCCGGGAGGGGCTGGAGGTGACCGAGGCCGGATCGGGCGAGGAGGGCCTGGCGAGGCTGGCGGAGCGGCCGTACG
ACATCGTGCTGCTGGACCTGGTGCTGCCCGGCCGCAGCGGCTTGGAGGTGTGCCGGGAGATCCGCCGGGTCTCCACCACG
CCGGTGATCATGGTGACCGCCCGCGCGGACAGCTCGGACGTCATCGCGGGCCTGGAGGCCGGTGCCGACGACTACGTCAC
CAAGCCCTTCGTGGCCGAGGAGCTCTCCGCCCGCATCCGCGCGCTGGCCCGCCGCACCGGGGGCTCGGGACCGCGGCCCC
GCATCGTCGTCGGCGACCTGGAGATCGCACCGGCGGACGGCGTGGTGACCCGCGGCGGCGAGGTCGTGCCGCTGACCAGG
ACCGAGTTCACGCTGCTCCTGGAGCTGGCCACCGAGCGCGGCCGGGTGTTCAGCCGCGAGGAGCTGCTGGAGCGGGTGTG
GGGCTACGACTACTTCGGCGACTCCCGGCTGGTCGACGTCCACGTGCGGCGGCTGCGCAAGAAGGTGGAGGCCGACCCGG
CCGCCCCGACGGTCGTGACCACGGTGCGCGGCATGGGCTACCGTCTGCCGGAGTGA

Protein sequence :
MGSPGGVARSVLIIEDDDRIRRVVSITLRREGLEVTEAGSGEEGLARLAERPYDIVLLDLVLPGRSGLEVCREIRRVSTT
PVIMVTARADSSDVIAGLEAGADDYVTKPFVAEELSARIRALARRTGGSGPRPRIVVGDLEIAPADGVVTRGGEVVPLTR
TEFTLLLELATERGRVFSREELLERVWGYDYFGDSRLVDVHVRRLRKKVEADPAAPTVVTTVRGMGYRLPE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-32 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-29 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-24 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-30 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-41 47
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-39 46
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-27 42
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 3e-32 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 5e-30 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 5e-30 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 8e-30 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-37 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-33 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-33 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-33 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-33 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-33 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-33 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-33 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-24 43
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-27 42
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator VFG1563 Protein 8e-31 41
Gobs_2351 YP_003409398.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-30 41