Gene Information

Name : Gobs_1217 (Gobs_1217)
Accession : YP_003408335.1
Strain : Geodermatophilus obscurus DSM 43160
Genome accession: NC_013757
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1277443 - 1277769 bp
Length : 327 bp
Strand : -
Note : PFAM: transposase IS3/IS911 family protein; KEGG: kra:Krad_2846 transposase IS3/IS911 family protein

DNA sequence :
ATGGCGGCACCGAGGAAGTACCCCGACGAGCTGCGTGAGCGGGCGATCCGCTTCGCGCTCGATCTGGTGGAGGGGCCGGA
GAAGCTGAGCGTCAACGCCGCCTGCAAGCGGGTCGGCGAGCAGCTGGGGATCGTGCCGGACTCGCTGCGGAACTGGGTGC
AGCAGGCTCGCGTCGACGCCGGCAGTGCGCCGGGCCTGACCACCGATGAGCGGGCGAGGCTGGCCGAGCTGGAGCGGGAG
AACCGCGAGCTGCGCCGGGCCAACGCCATCCTCAAGAGCGCGTCGGCTTTCTTCGCGGCCGAGCTCGACCGGCCATCCCA
GCGCTGA

Protein sequence :
MAAPRKYPDELRERAIRFALDLVEGPEKLSVNAACKRVGEQLGIVPDSLRNWVQQARVDAGSAPGLTTDERARLAELERE
NRELRRANAILKSASAFFAAELDRPSQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 0.041 48
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 0.25 48
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 0.18 48
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 7e-06 47
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 2e-05 47
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 1e-05 47
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-04 47
unnamed AAF09023.1 unknown Not tested SHI-O Protein 0.008 47
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-04 47
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 0.008 47
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 4e-04 47
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 7e-06 47
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 2e-05 47
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 7e-06 47
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 2e-05 47
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 7e-06 47
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 2e-05 47
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 0.75 46
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 0.016 46
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 0.016 46
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 0.011 46
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 0.009 46
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 0.011 46
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 0.022 46
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 0.022 46
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 0.022 46
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 0.022 46
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 0.016 46
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 0.016 46
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 0.016 46
CDCE8392_1959 YP_005134490.1 hypothetical protein Not tested Not named Protein 4e-07 41
tnp7109-26 YP_001800854.1 transposase for insertion sequence Not tested Not named Protein 2e-07 41
CDCE8392_1775 YP_005134309.1 transposase-like protein Not tested Not named Protein 9e-06 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gobs_1217 YP_003408335.1 transposase IS3/IS911 family protein VFG1603 Protein 0.017 48
Gobs_1217 YP_003408335.1 transposase IS3/IS911 family protein VFG0606 Protein 0.002 46
Gobs_1217 YP_003408335.1 transposase IS3/IS911 family protein VFG1717 Protein 0.005 46
Gobs_1217 YP_003408335.1 transposase IS3/IS911 family protein VFG0643 Protein 0.006 46