Gene Information

Name : Acfer_0820 (Acfer_0820)
Accession : YP_003398523.1
Strain : Acidaminococcus fermentans DSM 20731
Genome accession: NC_013740
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 952021 - 952719 bp
Length : 699 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: cce:Ccel_1658 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAACAAACAACAGACTGTATTGATCGCGGATGACGAACCGCAAATCCGTGAGATCTTAAGCATTTATTTCAAAAAAGA
GGGATTCAAGGTCATTGAAGCGGCAGACGGTGCCGAGGCTCTGGTGCAGGTCCAGGCCGGGAAACCGGACATCATCCTGC
TGGACATCATGATGCCGGTACTGGACGGGCTGGAAGTGTGCAAACAGGTCCGGAAGATCTCCGATATCCCCATCATCATG
CTCACTGCCAAGGATTCCGATGACGACCGGATCCTGGGGCTGGAAATCGGAGCGGACGACTACATTTCCAAACCCTTCAA
CACCCGGGAAGTGGTGGCACGGGTCAAGGCCGTGCTCCGGCGGACCAATGCCTCCATGAGCAGCCAGAACAAGCAGGTGC
TGGAATATCCCAACCTGATGATCAACCTGAGCGAATACCGGGTGGTGGCCTTCGGACGGGAAATCACCTTTACCGCCAAG
GAAATGGAACTGCTCTGGTGCCTGGCCTCCAACCCGGGAATCGTGTTCAGCCGGAACCAGCTGCTGGAAAAAATCTGGGG
CTATACCTATTACGGGGACACCCGCACCGTGGATACCCACATCAAACGGGTCCGGCACAAGCTGGATATTCCCCCTGATT
CCACCTGGGACATTATGACGGTCTGGGGTGTAGGGTACAAGTTCGAGGTCAAAAAGTGA

Protein sequence :
MNKQQTVLIADDEPQIREILSIYFKKEGFKVIEAADGAEALVQVQAGKPDIILLDIMMPVLDGLEVCKQVRKISDIPIIM
LTAKDSDDDRILGLEIGADDYISKPFNTREVVARVKAVLRRTNASMSSQNKQVLEYPNLMINLSEYRVVAFGREITFTAK
EMELLWCLASNPGIVFSRNQLLEKIWGYTYYGDTRTVDTHIKRVRHKLDIPPDSTWDIMTVWGVGYKFEVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SSU05_0907 YP_001198273.1 NisR Not tested 89K Protein 2e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 7e-49 47
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 4e-44 45
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 6e-44 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 9e-41 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 8e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 6e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 6e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 8e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 6e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 6e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 6e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 6e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 6e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 6e-43 44
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 1e-41 43
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-42 43
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-41 42
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-42 42
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family BAC0596 Protein 5e-39 42
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 5e-39 42
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-30 41
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 7e-38 41
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 1e-38 41
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 1e-38 41
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family BAC0039 Protein 1e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acfer_0820 YP_003398523.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-33 42