Gene Information

Name : Acfer_1547 (Acfer_1547)
Accession : YP_003399220.1
Strain : Acidaminococcus fermentans DSM 20731
Genome accession: NC_013740
Putative virulence/resistance : Resistance
Product : ArsR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0640
EC number : -
Position : 1707185 - 1707505 bp
Length : 321 bp
Strand : +
Note : PFAM: regulatory protein ArsR; SMART: regulatory protein ArsR; KEGG: blj:BLD_1091 arsenical resistance operon repressor

DNA sequence : 
ATGGAATCTTTATCCCATACAGCCCGACAGTTCAAGGCCCTGGGCGACGAAAACCGTCTCCACATCCTGGAACTTCTCCA
GGGAGGAGAACGGTGCGCCTGCGTGCTGCTGGAAAATCTCCATCTGTCCCAGCCCACCCTTTCCCACCATATGAAAATCC
TGTGCGACGCGGGGCTGGTCACCGGTCGGAAAGAAGGCAAATGGGTCTACTATACCCTGAACCGGAACACAGCCCGGGAA
CTGGAAGAACGGATCCGGGCCCTGTTCCGGGAAATCCCCTCTCTCCAGCCGACGGACTGCAACTGCCACAAGTGCCAGTA
A

Protein sequence : 
MESLSHTARQFKALGDENRLHILELLQGGERCACVLLENLHLSQPTLSHHMKILCDAGLVTGRKEGKWVYYTLNRNTARE
LEERIRALFREIPSLQPTDCNCHKCQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR YP_252025.1 arsenical resistance operon repressor Not tested SCCmec Protein 2e-13 49
arsR YP_005754066.1 arsenical resistance operon repressor Not tested Type-XI SCCmec Protein 1e-11 49
arsR YP_252018.1 arsenical resistance operon repressor Not tested SCCmec Protein 7e-13 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acfer_1547 YP_003399220.1 ArsR family transcriptional regulator BAC0590 Protein 4e-13 47
Acfer_1547 YP_003399220.1 ArsR family transcriptional regulator BAC0593 Protein 6e-11 43