Gene Information

Name : Cwoe_5905 (Cwoe_5905)
Accession : YP_003397680.1
Strain : Conexibacter woesei DSM 14684
Genome accession: NC_013739
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6317730 - 6318443 bp
Length : 714 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sat:SYN_00981 response regulator

DNA sequence :
ATGACCGAGCGATCGACCCGCATCCTGCTGGTGGACGACGAGCAGTCGATCCAGGCGCTGCTGTCGTACCCGCTGCGCAG
AGACGGCTACGAAGTCGTGCAGGCGACCGACGGGCGTGAGGCGCTGGCGCGCTTCGAGGAACGCCCGTTCGACCTCGTCG
TGCTCGACGTGATGCTGCCACAGCTGGACGGGCTGGAGGTCTGCCGGCGCCTGCGCAGCCGCAGCTCGGTGCCGATCATC
ATGCTGACGGCGAAGTCCGAGGAGATCGACAAGGTCGTCGGGCTGGAGATCGGCGCCGACGACTACATCACCAAGCCGTT
CTCGATGCGCGAGTTCCGCAGCCGCGTGAAGGCGGCGCTGCGGCGCTCGGAGCTGTCGCGCTCGGCCGAGCGCGACGGCG
GCTCGCTCGACGTGCACGAGCTGCGGATCGACCCCGACAAGCGGACCGTCAGCCTCCGCGGCGAGGCGATCACGACGACG
TTCGTCGAGTTCGAGATCCTGCTCACGCTCGCCCGCAGCCCCGGTCGCGTCTTCACGCGCGACATGCTGCTCGCTCGCGT
CTGGGGCGACTCCGCCTACCGTGACCCGCGCACGATCGACGTCCACATCCGCCACCTGCGCGAGAAGATCGAGCGCGACG
CGAAGGAGCCCGAATACCTCTTCACCGTGCGCGGCGTCGGCTACCGCTTCCGCGACACGGACGCCTCCTCCTAG

Protein sequence :
MTERSTRILLVDDEQSIQALLSYPLRRDGYEVVQATDGREALARFEERPFDLVVLDVMLPQLDGLEVCRRLRSRSSVPII
MLTAKSEEIDKVVGLEIGADDYITKPFSMREFRSRVKAALRRSELSRSAERDGGSLDVHELRIDPDKRTVSLRGEAITTT
FVEFEILLTLARSPGRVFTRDMLLARVWGDSAYRDPRTIDVHIRHLREKIERDAKEPEYLFTVRGVGYRFRDTDASS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-38 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-42 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-41 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-41 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-42 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-41 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-41 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-41 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-41 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-41 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-41 50
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-45 49
Cwoe_5905 YP_003397680.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-43 48
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-44 46
Cwoe_5905 YP_003397680.1 two component transcriptional regulator AE000516.2.gene3505. Protein 6e-43 44
Cwoe_5905 YP_003397680.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-40 43
Cwoe_5905 YP_003397680.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-42 43
Cwoe_5905 YP_003397680.1 two component transcriptional regulator BAC0596 Protein 5e-32 43
Cwoe_5905 YP_003397680.1 two component transcriptional regulator BAC0039 Protein 4e-33 43
Cwoe_5905 YP_003397680.1 two component transcriptional regulator CP001138.1.gene2239. Protein 5e-32 43
Cwoe_5905 YP_003397680.1 two component transcriptional regulator CP000034.1.gene2186. Protein 4e-33 43
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_002695.1.916589.p Protein 4e-33 43
Cwoe_5905 YP_003397680.1 two component transcriptional regulator AE016830.1.gene1681. Protein 5e-43 43
Cwoe_5905 YP_003397680.1 two component transcriptional regulator CP001918.1.gene3444. Protein 9e-32 42
Cwoe_5905 YP_003397680.1 two component transcriptional regulator CP000647.1.gene2531. Protein 4e-31 42
Cwoe_5905 YP_003397680.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-34 41
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 7e-38 41
Cwoe_5905 YP_003397680.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 7e-38 41
Cwoe_5905 YP_003397680.1 two component transcriptional regulator AM180355.1.gene1830. Protein 7e-36 41
Cwoe_5905 YP_003397680.1 two component transcriptional regulator CP000034.1.gene3671. Protein 4e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_5905 YP_003397680.1 two component transcriptional regulator VFG1702 Protein 6e-39 41
Cwoe_5905 YP_003397680.1 two component transcriptional regulator VFG1563 Protein 4e-38 41
Cwoe_5905 YP_003397680.1 two component transcriptional regulator VFG1389 Protein 1e-22 41