Gene Information

Name : Cwoe_4710 (Cwoe_4710)
Accession : YP_003396498.1
Strain : Conexibacter woesei DSM 14684
Genome accession: NC_013739
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5025972 - 5026646 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 transcriptional regulator

DNA sequence : 
ATGCGCATCCTGGTGATCGAGGACGAGACCGCGATCGCCGACTTCGTGCAGCGCGGTCTGCAGGCGGAGGGCTACGCGGT
CTCGATCGCGGGCGACGGGATCGAGGGCGAGCGGCGCGCGCTGCACGACGACGTCGACCTCGTCGTGCTCGACGTGATGC
TGCCGGGACGTGACGGGCTGGCGGTGCTGTCGTCGATCCGGCGGGTGAAGCCGGAGCTGCCTGTCGTGATGCTGAGCGCC
CGCGCGACGGTCGACGACCGCGTCGCCGGGCTCGACGGCGGCGCGACCGACTACGTCACGAAGCCGTTCTCCTTCGACGA
GCTGGCGGCGCGGGTGCGCGCGCATCTGCGCAGGCCGCGCCAGCGGGACGCGACGACGCTGTCGGCGGCGGGGATAGAGC
TGGACCTGCTCGGTCGCAACGTCAGACGCGAAGGCGTCGAGCTGCGGCTCTCAGCGCGAGAGTTCGACCTGCTCGCCTAC
TTCCTGCGCCATCCCGACCAGGCGCTGTCGCGCCAGCAGATCCTCAGCGCGGTCTGGGGCTACGACTTCGATCCCGGCAC
GAACGTGGTGGAGGTCTACATCCGCTACCTGCGGCGCAAACTCGAGCTGCCCGGCAGACCGACCCCGATCGACACGCTGC
GATCGGTCGGATACCGGCTCACGACACGGCCATGA

Protein sequence : 
MRILVIEDETAIADFVQRGLQAEGYAVSIAGDGIEGERRALHDDVDLVVLDVMLPGRDGLAVLSSIRRVKPELPVVMLSA
RATVDDRVAGLDGGATDYVTKPFSFDELAARVRAHLRRPRQRDATTLSAAGIELDLLGRNVRREGVELRLSAREFDLLAY
FLRHPDQALSRQQILSAVWGYDFDPGTNVVEVYIRYLRRKLELPGRPTPIDTLRSVGYRLTTRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-32 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-31 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_4710 YP_003396498.1 two component transcriptional regulator BAC0125 Protein 3e-37 46
Cwoe_4710 YP_003396498.1 two component transcriptional regulator BAC0197 Protein 1e-37 45
Cwoe_4710 YP_003396498.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-31 44
Cwoe_4710 YP_003396498.1 two component transcriptional regulator BAC0638 Protein 6e-28 44
Cwoe_4710 YP_003396498.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-33 43
Cwoe_4710 YP_003396498.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-33 43
Cwoe_4710 YP_003396498.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-33 43
Cwoe_4710 YP_003396498.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-33 43
Cwoe_4710 YP_003396498.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-33 43
Cwoe_4710 YP_003396498.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-33 43
Cwoe_4710 YP_003396498.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-33 43
Cwoe_4710 YP_003396498.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-33 43
Cwoe_4710 YP_003396498.1 two component transcriptional regulator BAC0083 Protein 9e-32 42
Cwoe_4710 YP_003396498.1 two component transcriptional regulator BAC0308 Protein 1e-32 42
Cwoe_4710 YP_003396498.1 two component transcriptional regulator HE999704.1.gene1528. Protein 5e-30 41
Cwoe_4710 YP_003396498.1 two component transcriptional regulator AE000516.2.gene3505. Protein 9e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_4710 YP_003396498.1 two component transcriptional regulator VFG1389 Protein 2e-40 48
Cwoe_4710 YP_003396498.1 two component transcriptional regulator VFG1390 Protein 6e-38 44
Cwoe_4710 YP_003396498.1 two component transcriptional regulator VFG0596 Protein 2e-32 44
Cwoe_4710 YP_003396498.1 two component transcriptional regulator VFG1386 Protein 4e-36 42