Gene Information

Name : Cwoe_0293 (Cwoe_0293)
Accession : YP_003392104.1
Strain : Conexibacter woesei DSM 14684
Genome accession: NC_013739
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 301108 - 301788 bp
Length : 681 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: glo:Glov_0998 transcriptional regulator

DNA sequence :
ATGCGCGTCCTGGTCATCGAGGACGAGCCGAAGCTGCGCGCCGCGATCCGCCGCGGGCTGACCGAGGACGGGCTCGTCTG
CGACGTCGCGGAGCGCGGCGAGGACGCGCTCTGGATGGCCGGCTCCTCCGCGTACGACGCGATCGTGCTCGACGTGATGC
TGCCGGGGATCGACGGCTTCGAGACGTGCCGGCGGCTGCGCGCCGACGGCGTCTGGGCGCCGGTGCTGATGCTGACCGCG
CGCGACGCGGTCGAGGACCGCGTCGCCGGGCTCGACACGGGCGCCGACGACTACGTCACGAAGCCGTTCTCGCTCGCGGA
GCTGTCGGCGCGGCTGCGGGCGCTGGCGCGGCGCGGCCCAGTGCAGCGGCCGGCGGTGCTCGCGGCCGGCGACCTCACGC
TCGACCCCGCGACGCGCCGCGTCGCGCGCGGCGAGGTCGAGATCGAGCTGTCGGCGCGCGAGTACGCGCTGCTGGAGGCG
TTCATGCGGCGGCCCGGCGAGGTGCTCGAGCGCCACGTGCTGCTCGACCTCGCCTGGGGCCGCGACTACGAGAACCGCTC
GAACGTGGTCGACGTCTACGTGCGCTATCTGCGCGAGAGAGTCGACCGGCCGTTCGGCGCCGAGGCGATCGAGACGCTGC
GCGGCGTCGGCTACCGGCTGCGCGCCGACGGTGGCCGCTGA

Protein sequence :
MRVLVIEDEPKLRAAIRRGLTEDGLVCDVAERGEDALWMAGSSAYDAIVLDVMLPGIDGFETCRRLRADGVWAPVLMLTA
RDAVEDRVAGLDTGADDYVTKPFSLAELSARLRALARRGPVQRPAVLAAGDLTLDPATRRVARGEVEIELSAREYALLEA
FMRRPGEVLERHVLLDLAWGRDYENRSNVVDVYVRYLRERVDRPFGAEAIETLRGVGYRLRADGGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-31 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-31 43
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-16 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_0293 YP_003392104.1 two component transcriptional regulator BAC0125 Protein 1e-40 48
Cwoe_0293 YP_003392104.1 two component transcriptional regulator BAC0083 Protein 1e-37 48
Cwoe_0293 YP_003392104.1 two component transcriptional regulator BAC0638 Protein 8e-29 47
Cwoe_0293 YP_003392104.1 two component transcriptional regulator BAC0197 Protein 1e-35 47
Cwoe_0293 YP_003392104.1 two component transcriptional regulator BAC0308 Protein 2e-34 45
Cwoe_0293 YP_003392104.1 two component transcriptional regulator HE999704.1.gene1528. Protein 6e-34 44
Cwoe_0293 YP_003392104.1 two component transcriptional regulator Y16952.3.orf35.gene. Protein 1e-27 43
Cwoe_0293 YP_003392104.1 two component transcriptional regulator AE015929.1.gene1106. Protein 4e-28 42
Cwoe_0293 YP_003392104.1 two component transcriptional regulator BAC0111 Protein 8e-38 42
Cwoe_0293 YP_003392104.1 two component transcriptional regulator BAC0347 Protein 2e-34 42
Cwoe_0293 YP_003392104.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 2e-24 42
Cwoe_0293 YP_003392104.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-31 41
Cwoe_0293 YP_003392104.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-31 41
Cwoe_0293 YP_003392104.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-31 41
Cwoe_0293 YP_003392104.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-31 41
Cwoe_0293 YP_003392104.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-31 41
Cwoe_0293 YP_003392104.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-31 41
Cwoe_0293 YP_003392104.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-31 41
Cwoe_0293 YP_003392104.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_0293 YP_003392104.1 two component transcriptional regulator VFG1390 Protein 4e-37 48
Cwoe_0293 YP_003392104.1 two component transcriptional regulator VFG0596 Protein 5e-32 44
Cwoe_0293 YP_003392104.1 two component transcriptional regulator VFG1386 Protein 6e-30 43
Cwoe_0293 YP_003392104.1 two component transcriptional regulator VFG1389 Protein 2e-28 41