Gene Information

Name : Cwoe_1564 (Cwoe_1564)
Accession : YP_003393367.1
Strain : Conexibacter woesei DSM 14684
Genome accession: NC_013739
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1654066 - 1654737 bp
Length : 672 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 transcriptional regulator

DNA sequence :
ATGCGGATCCTCGTCGTCGACGACGAGCCGGCGGTGCGGACGGCGCTCGAGCGGGCGCTGCGGCTCGACGGCTACGAGGT
CGCCCTCGCGGCGGACGGGCAGGAGGCGCTCGACGCGCTCGCGGGCGTCGCGCCAGACGCTGTCGTGCTCGACCTGCTGA
TGCCGCAGGTCGGCGGGGTCGAGGTCTGCCGGCGGCTGCGCGCCGCGGGCGACCGCACGCCGGTCCTGATGCTGACCGCG
CGCGACCGCATCGCGGACCGCGTGAGCGGCCTCGACGCCGGCGCCGACGACTACCTCGTCAAGCCGTTCGCGCTGGAGGA
GCTGTCGGCGCGGCTGCGCGCGCTGCTGCGCCGCGCCGGCGCCGACGAGCACGATCGGCTGCGCTTCGGCGACCTCGTGC
TCGACCAGGCCGCGCACGAGGTGCGTCGCGGCGAGCGGGAGATCGAGCTGACGCGGACGGAGTTCCTGCTGCTGGAGCTG
CTGCTCCGCCATCCGCGCCAGGTGCTCCCCCGCAGCGTGATCTTCGAGCACGTGTGGGGCTACGACTTCGGCTCGACGTC
GAACTCGCTGGAGGTCTACGTCGGCTACCTGCGCCGCAAGACCGAGGCCGGCGACGAGCCGCGGCTGATCCACACGGTCC
GCGGCGTCGGCTACGTCCTGCGCGAGCGATGA

Protein sequence :
MRILVVDDEPAVRTALERALRLDGYEVALAADGQEALDALAGVAPDAVVLDLLMPQVGGVEVCRRLRAAGDRTPVLMLTA
RDRIADRVSGLDAGADDYLVKPFALEELSARLRALLRRAGADEHDRLRFGDLVLDQAAHEVRRGEREIELTRTEFLLLEL
LLRHPRQVLPRSVIFEHVWGYDFGSTSNSLEVYVGYLRRKTEAGDEPRLIHTVRGVGYVLRER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-21 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_1564 YP_003393367.1 two component transcriptional regulator BAC0083 Protein 7e-27 48
Cwoe_1564 YP_003393367.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-34 47
Cwoe_1564 YP_003393367.1 two component transcriptional regulator BAC0125 Protein 2e-28 45
Cwoe_1564 YP_003393367.1 two component transcriptional regulator BAC0197 Protein 1e-24 45
Cwoe_1564 YP_003393367.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-31 45
Cwoe_1564 YP_003393367.1 two component transcriptional regulator BAC0308 Protein 6e-25 44
Cwoe_1564 YP_003393367.1 two component transcriptional regulator BAC0638 Protein 1e-26 44
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-27 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-27 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-27 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-27 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-27 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-27 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-27 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-27 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_002516.2.879194.p Protein 5e-17 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator BAC0347 Protein 9e-23 43
Cwoe_1564 YP_003393367.1 two component transcriptional regulator BAC0111 Protein 4e-26 42
Cwoe_1564 YP_003393367.1 two component transcriptional regulator NC_012469.1.7686381. Protein 9e-27 41
Cwoe_1564 YP_003393367.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 9e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_1564 YP_003393367.1 two component transcriptional regulator VFG1390 Protein 5e-53 65
Cwoe_1564 YP_003393367.1 two component transcriptional regulator VFG1389 Protein 1e-35 50
Cwoe_1564 YP_003393367.1 two component transcriptional regulator VFG1386 Protein 2e-38 49
Cwoe_1564 YP_003393367.1 two component transcriptional regulator VFG0596 Protein 2e-21 41