Gene Information

Name : Kfla_3513 (Kfla_3513)
Accession : YP_003381370.1
Strain : Kribbella flavida DSM 17836
Genome accession: NC_013729
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3778822 - 3779532 bp
Length : 711 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGCGAATCCTGGTCGTCGAGGACGAGCGCCGGCTGGCCCGCGCCATCGGGCACGGTCTGGAGGACCACGGTTTCACCGT
CGAACTGGCGCACGACGGTGAAACCGGCCTGTGGAAGGGCCGGGAGCAGGACTACGACGCGATCGTGCTCGACCTGATGC
TGCCCGGGCTGTCCGGCGACGAGGTGTGCCGGCAGCTGCGGGCCGCAGGGTGCTGGACGCCGATCCTGATCCTCACCGCG
CGGGTCGGCGCCGAGGCCGAAGCCGGTGGGCTGAACCTCGGCGCCGACGACTACCTGCGCAAGCCGTTCTCGTACCAGGT
ACTGATCGCGCGGCTCAACGCGCTGCTGCGGCGGACCGCGCCGGCCCGGCCGGTCAACCTCGTCGTCGGCGACCTGGTGC
TCGACCCGGCCCGGCGTACGGTCCGGCGGGGCACGACGCCGATCGAGCTGACCCGGCGGGAGTTCTCGGTGCTGGAGTAC
CTGATGCGCAACGCCGGCAGCACCCGCTCGAAGGCGGAGATCCTCGACCACGTCTGGGGCGCGGACTTCGACCGGGAGCC
GAACGTCGTCGAGGTCTACGTCGGCTACCTGCGGCGCAAGATCGACCAGCCGTTCGGCACCGGAAGCATCCGGACGGTCC
GTGGCCACGGCTACCTGATGGGCGACGAGGACCCCCGCGCCCCGGAGCCGGTGGCGACCGGCGATGGGTGA

Protein sequence : 
MRILVVEDERRLARAIGHGLEDHGFTVELAHDGETGLWKGREQDYDAIVLDLMLPGLSGDEVCRQLRAAGCWTPILILTA
RVGAEAEAGGLNLGADDYLRKPFSYQVLIARLNALLRRTAPARPVNLVVGDLVLDPARRTVRRGTTPIELTRREFSVLEY
LMRNAGSTRSKAEILDHVWGADFDREPNVVEVYVGYLRRKIDQPFGTGSIRTVRGHGYLMGDEDPRAPEPVATGDG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-37 46
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-35 44
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 4e-25 44
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-29 43
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 4e-32 43
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-36 42
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-33 42
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 1e-21 42
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 8e-32 42
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-29 42
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-31 41
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator BAC0308 Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-40 48
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-33 44
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-32 42
Kfla_3513 YP_003381370.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-30 41