Gene Information

Name : Psta_3695 (Psta_3695)
Accession : YP_003372213.1
Strain : Pirellula staleyi DSM 6068
Genome accession: NC_013720
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 4820489 - 4820824 bp
Length : 336 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: ank:AnaeK_3965 IS66 Orf2 family protein

DNA sequence :
ATGATTGGGCCTCGTGACGGTTCCACTGCGGCGCAAGTCTGGATCGCCACCGCGCCGGTCGACATGCGCAAGAGCTTCGA
CGGCCTGGCCGAGATCGTCCGCGCGTTTCTCGGGCAAGACCCGCTCTCGGGCCACTTGTTCGTGTTTCGCAACAAGTCGA
GTCAGCGGCTCAAGATCTTATGGTGGGATCGCGGCGGGCTGACGATCTACTACAAGCGGTTGGAACGCGGCGTGTTCCGC
TTCCCGTCGACGAAGGACAGCGCACTCGCCGTCGATAGTTCCCAACTGCTGCGGCTGCTCGATGGCCTGGAAGTTGTCGC
GCGCCGGGCGAGCTGA

Protein sequence :
MIGPRDGSTAAQVWIATAPVDMRKSFDGLAEIVRAFLGQDPLSGHLFVFRNKSSQRLKILWWDRGGLTIYYKRLERGVFR
FPSTKDSALAVDSSQLLRLLDGLEVVARRAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 4e-18 45
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 4e-18 45
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 8e-19 44
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 8e-19 44
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-14 43
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-16 43
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-18 43
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-18 43
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-18 43
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-17 42
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-18 42
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-18 42
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-16 42
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-16 42
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-17 41
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-17 41
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-17 41
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-18 41
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-17 41
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-17 41
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-17 41
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-17 41
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psta_3695 YP_003372213.1 IS66 Orf2 family protein VFG1517 Protein 1e-14 43
Psta_3695 YP_003372213.1 IS66 Orf2 family protein VFG1737 Protein 3e-19 43
Psta_3695 YP_003372213.1 IS66 Orf2 family protein VFG1052 Protein 8e-18 42
Psta_3695 YP_003372213.1 IS66 Orf2 family protein VFG1665 Protein 1e-18 41
Psta_3695 YP_003372213.1 IS66 Orf2 family protein VFG0792 Protein 1e-17 41
Psta_3695 YP_003372213.1 IS66 Orf2 family protein VFG1709 Protein 1e-17 41