Gene Information

Name : Psta_3237 (Psta_3237)
Accession : YP_003371761.1
Strain : Pirellula staleyi DSM 6068
Genome accession: NC_013720
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4190626 - 4191297 bp
Length : 672 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: rru:Rru_A2913 two component transcriptional regulator

DNA sequence :
GTGAAACTGTTAGTCATCGAGGATGACCCCGTGCTTGGGAAAGCACTGGAGCGCGGCCTCTCCGAAGCGGGACACTTTTG
TCAGTGGGAACGGACTGGGAAATCGGGGCTCGAACAAGCCTCAACCCAGCAGTTTGATGCGCTGGTGCTCGATGTCATGC
TGCCCGATACAACCGGCATGGAGGTGGTTCGCAAGATTCGGCACGACGGAATCGGCACCCCGGTTTTGATGCTCACAGCA
CTTGGTTCAGTCGACGACCGGGTCGCGGGGCTCAACAGCGGGGCCGATGATTACCTCGTCAAACCGTTTGCTTTCCCCGA
GCTTTTGGCTCGGCTAGATGCCATCAGTCGCCGCACAAAAGATCGCCCCAGTTCGCAGCTGAAGGTGGGTCCTCTGGTAC
TCGATCTCACCAATCGCAAAGTAACGCGCAACGATAGCGAACTGAGCCTGACTCCCACGGAGTTCAGCCTGCTCGAGTTT
TTGATGCGCTACGCCGGGCAGGTTGTCACTCGCAAAATGCTCTGTGAGCACCTGTGGGAATCGGACTGGGAAGGGGTCAC
TAACGTTGTCGAAGTGCACATCAATCGACTTCGCGGTAAGATTGATCGCGGCTTCTCTGAGCCGCTGATTCAAACCGTCC
GAGGCCGGGGATATGTTCTTCGAACAACTTAG

Protein sequence :
MKLLVIEDDPVLGKALERGLSEAGHFCQWERTGKSGLEQASTQQFDALVLDVMLPDTTGMEVVRKIRHDGIGTPVLMLTA
LGSVDDRVAGLNSGADDYLVKPFAFPELLARLDAISRRTKDRPSSQLKVGPLVLDLTNRKVTRNDSELSLTPTEFSLLEF
LMRYAGQVVTRKMLCEHLWESDWEGVTNVVEVHINRLRGKIDRGFSEPLIQTVRGRGYVLRTT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-34 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-50 48
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-45 48
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-46 48
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator BAC0347 Protein 6e-46 47
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-44 46
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-40 46
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 9e-35 42
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator BAC0487 Protein 6e-29 41
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 9e-30 41
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-29 41
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-41 41
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-27 41
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 5e-22 41
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 5e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-37 44
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-29 43
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-34 42
Psta_3237 YP_003371761.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-34 41