Gene Information

Name : ROD_50441 (ROD_50441)
Accession : YP_003368401.1
Strain : Citrobacter rodentium ICC168
Genome accession: NC_013716
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5292614 - 5293294 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
ATGAAGATTTTACTGATTGAAGACAACCAAAAAACCCGCGACTGGGTAAGTCAGGGGCTGAGCGAAGCTGGCTACGTCGT
GGACCAGGCGAGCGACGGCAAAGAGGGATTGCGCTTCGCGTTACAGGAATCTTACGCGTTAATCATCCTGGATATTATGC
TGCCGGGGCTCGACGGCTGGCAGGTGCTTAAGGCGCTCAGAACGGCAAACCAGACGCCGGTGATTTGCCTTACTGCCCGC
GACGCGGTCGAAGACCGGGTAAAAGGGCTGGAGTCCAGCGCCAATGATTATCTGGTTAAACCCTTCTCTTTCGCCGAGCT
GCTGGCGCGGGTACGCGCGCAGTTGAGAAATCATTCGCCTCATCATACCTATCTGAAAATCAGCGGACTGGAGATGGATT
CCGTCAGGCAAAGCGTCAGCAGAGACGGAAAAGCCATTGTATTAACCCGCAAAGAGTTTCTTCTGCTGTGGCTGCTGGCG
TCCAGAGCCGGAGAAATTATCCCGAGGACCGTAATCGCCAGCGAAGTGTGGGGCATTAATTTTGACAGCGAGACCAATAC
GGTTGATGTCGCCATACGTCGGCTACGGTCGAAAGTGGACGATCCCTTCGACGTTAAGCTCATCGGCACCGTCAGGGGAA
TGGGCTACCGGTTCCGGGCGGATGAACATCATGAAGCCTGA

Protein sequence :
MKILLIEDNQKTRDWVSQGLSEAGYVVDQASDGKEGLRFALQESYALIILDIMLPGLDGWQVLKALRTANQTPVICLTAR
DAVEDRVKGLESSANDYLVKPFSFAELLARVRAQLRNHSPHHTYLKISGLEMDSVRQSVSRDGKAIVLTRKEFLLLWLLA
SRAGEIIPRTVIASEVWGINFDSETNTVDVAIRRLRSKVDDPFDVKLIGTVRGMGYRFRADEHHEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-86 80
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-85 78

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROD_50441 YP_003368401.1 two-component response regulator BAC0197 Protein 5e-58 59
ROD_50441 YP_003368401.1 two-component response regulator BAC0125 Protein 2e-57 57
ROD_50441 YP_003368401.1 two-component response regulator BAC0083 Protein 2e-56 55
ROD_50441 YP_003368401.1 two-component response regulator BAC0638 Protein 5e-54 55
ROD_50441 YP_003368401.1 two-component response regulator BAC0308 Protein 3e-53 54
ROD_50441 YP_003368401.1 two-component response regulator BAC0347 Protein 1e-49 51
ROD_50441 YP_003368401.1 two-component response regulator BAC0111 Protein 1e-53 50
ROD_50441 YP_003368401.1 two-component response regulator NC_002758.1121390.p0 Protein 4e-38 43
ROD_50441 YP_003368401.1 two-component response regulator NC_010079.5776364.p0 Protein 4e-38 43
ROD_50441 YP_003368401.1 two-component response regulator NC_002952.2859858.p0 Protein 4e-38 43
ROD_50441 YP_003368401.1 two-component response regulator NC_007622.3794948.p0 Protein 4e-38 43
ROD_50441 YP_003368401.1 two-component response regulator AE015929.1.gene1106. Protein 4e-33 43
ROD_50441 YP_003368401.1 two-component response regulator NC_003923.1003417.p0 Protein 4e-38 43
ROD_50441 YP_003368401.1 two-component response regulator NC_013450.8614146.p0 Protein 4e-38 43
ROD_50441 YP_003368401.1 two-component response regulator NC_002951.3238224.p0 Protein 4e-38 43
ROD_50441 YP_003368401.1 two-component response regulator NC_007793.3914065.p0 Protein 4e-38 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROD_50441 YP_003368401.1 two-component response regulator VFG0596 Protein 2e-86 80
ROD_50441 YP_003368401.1 two-component response regulator VFG1389 Protein 7e-32 41