Gene Information

Name : ROD_50121 (ROD_50121)
Accession : YP_003368373.1
Strain : Citrobacter rodentium ICC168
Genome accession: NC_013716
Putative virulence/resistance : Unknown
Product : IS679 transposase B
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 5265539 - 5265886 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
ATGATATCTCTCCCTGCCGGTTCGCGTATCTGGCTGGTTGCCGGTATCACCGATATGCGAAATGGTTTTAACGGCCTGGC
ATCAAAAGTTCAGAACGTCCTGAAGAATGACCCGTTCTCCGGGCATCTGTTCATCTTTCGCGGACGCCGGGGTGACCAGA
TAAAAGTGTTGTGGGCTGACAGCGACGGACTGTGCCTCTTCACCAAACGCCTGGAACTGGGCCGCTTCGTCTGGCCGGTC
ACCCGCGATGGAAAGGTTCACCTTACTCCGGCTCAGTTATCTATGCTTCTTGAAGGTATCAACTGGAAGCACCCGAAACG
AACAGAACGCGCTGGAATCCGTATATAA

Protein sequence :
MISLPAGSRIWLVAGITDMRNGFNGLASKVQNVLKNDPFSGHLFIFRGRRGDQIKVLWADSDGLCLFTKRLELGRFVWPV
TRDGKVHLTPAQLSMLLEGINWKHPKRTERAGIRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-49 99
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-49 99
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 9e-49 98
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-44 80
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-44 80
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-38 75
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-38 75
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 3e-29 74
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-37 74
unnamed AAC31493.1 L0014 Not tested LEE Protein 5e-38 74
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-37 74
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 5e-38 74
unnamed AAL99258.1 unknown Not tested LEE Protein 5e-38 74
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 5e-38 74
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-38 74
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 7e-38 74
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 7e-38 74
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 7e-38 74
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-38 73
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-38 70
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-38 70
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-38 68
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-37 68
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-37 68
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-30 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROD_50121 YP_003368373.1 IS679 transposase B VFG1665 Protein 4e-49 98
ROD_50121 YP_003368373.1 IS679 transposase B VFG1698 Protein 5e-39 75
ROD_50121 YP_003368373.1 IS679 transposase B VFG1517 Protein 1e-29 74
ROD_50121 YP_003368373.1 IS679 transposase B VFG1709 Protein 2e-38 74
ROD_50121 YP_003368373.1 IS679 transposase B VFG0792 Protein 2e-38 74
ROD_50121 YP_003368373.1 IS679 transposase B VFG1052 Protein 3e-38 73
ROD_50121 YP_003368373.1 IS679 transposase B VFG1737 Protein 1e-38 68