Gene Information

Name : ROD_49791 (ROD_49791)
Accession : YP_003368344.1
Strain : Citrobacter rodentium ICC168
Genome accession: NC_013716
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 5231708 - 5231914 bp
Length : 207 bp
Strand : -
Note : -

DNA sequence :
ATGAATACCCCAGTTTCGCTGATGGATGACCAGATGGTCGACATGGCGTTTATCACTCAACTGACCGGCTTAACCGATAA
GTGGTTTTACAAGCTCATCAAGGATGGTGCCTTTCCGGCCCCCATCAAACTCGGCCGCAGCTCCCGATGGCTGAAAAGTG
AAGTGGAAGCCTGGTTGCAGGCGCGTATTGCACAATCCCGTCCGTAA

Protein sequence :
MNTPVSLMDDQMVDMAFITQLTGLTDKWFYKLIKDGAFPAPIKLGRSSRWLKSEVEAWLQARIAQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 9e-27 99
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 2e-26 96
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 5e-26 96
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 3e-26 96
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 3e-26 96
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 7e-26 96
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 7e-26 96
unnamed AAL08466.1 unknown Not tested SRL Protein 4e-26 95
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 1e-14 70
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 1e-14 70
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 6e-18 70
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-18 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROD_49791 YP_003368344.1 transcriptional regulator VFG0651 Protein 8e-27 96
ROD_49791 YP_003368344.1 transcriptional regulator VFG1057 Protein 2e-26 95
ROD_49791 YP_003368344.1 transcriptional regulator VFG1480 Protein 2e-18 70