Gene Information

Name : ler (ROD_30151)
Accession : YP_003366522.1
Strain : Citrobacter rodentium ICC168
Genome accession: NC_013716
Putative virulence/resistance : Virulence
Product : Ler transcriptional regulator
Function : -
COG functional category : R : General function prediction only
COG ID : COG2916
EC number : -
Position : 3179849 - 3180238 bp
Length : 390 bp
Strand : -
Note : positive regulator

DNA sequence :
ATGAGGAGATTATTTATTATGAATATGGAAACTAATTCGCCCACAACAAGCCCATACATTCAGCTGATTGAGCAGATTGC
TGTGCTACAGCAAGAAGCAAAGCGGCTGCGTGAGCAGGAGATTCAAACTGTAATTGAGTCAATTCAAAAACAGATTACTT
ATTACAATATAACCTTACAAGAACTGGGGTATACTAATATACCTGATGGTGCTCTTGCTCGCCGGAGCTCATCAAAAGGG
GTATACTACCGTAATGAAGACGGACAGACTTGGTCTGGAGTGGGTCGACAACCACGTTGGCTTAAAGAAGCATTATTGAA
TGGAAGAAAGAAAGAAGATTTTCTTGTGAAGGACACAGAAGAAGAAGTAACATCTCTGAATAACATTTAA

Protein sequence :
MRRLFIMNMETNSPTTSPYIQLIEQIAVLQQEAKRLREQEIQTVIESIQKQITYYNITLQELGYTNIPDGALARRSSSKG
VYYRNEDGQTWSGVGRQPRWLKEALLNGRKKEDFLVKDTEEEVTSLNNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL06349.1 LEE-encoded regulator Virulence LEE Protein 1e-55 100
ler AAL57584.1 Ler Virulence LEE Protein 4e-52 90
Z5140 NP_290288.1 hypothetical protein Not tested LEE Protein 6e-52 90
ler CAC81843.1 Ler protein Not tested LEE II Protein 4e-52 90
ECs4588 NP_312615.1 hypothetical protein Virulence LEE Protein 6e-52 90
unnamed AAC31533.1 L0054 Not tested LEE Protein 4e-52 90
ler YP_003236108.1 transcriptional regulator Ler Not tested LEE Protein 4e-52 90
ler ACU09478.1 transcription regulator Ler Not tested LEE Protein 4e-52 90
unnamed AAC38364.1 Orf1 Virulence LEE Protein 3e-52 90
ler AAK26696.1 Ler Virulence LEE Protein 4e-52 90
ler YP_003223495.1 transcription regulator Ler Not tested LEE Protein 6e-52 90
ler AAL57523.1 Ler Virulence LEE Protein 4e-52 90
ler YP_003232133.1 transcriptional regulator Ler Not tested LEE Protein 6e-52 90
ler CAI43893.1 LEE encoded regulator Virulence LEE Protein 6e-38 77
ler AFO66332.1 locus of enterocyte effacement-encoded regulator Virulence SESS LEE Protein 3e-34 61
ler AFO66395.1 locus of enterocyte effacement (LEE)-encoded regulator Virulence SESS LEE Protein 3e-34 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ler YP_003366522.1 Ler transcriptional regulator VFG0832 Protein 2e-52 90
ler YP_003366522.1 Ler transcriptional regulator VFG0710 Protein 1e-52 90