Gene Information

Name : marA (ROD_15071)
Accession : YP_003365090.1
Strain : Citrobacter rodentium ICC168
Genome accession: NC_013716
Putative virulence/resistance : Resistance
Product : multiple antibiotic resistance regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 1603003 - 1603383 bp
Length : 381 bp
Strand : -
Note : -

DNA sequence :
ATGTCCAGACGCAATACTGACGCTATCACCATTCACAGCATTTTGGACTGGATCGAAGATAACCTGGAATCGCCGCTCTC
ACTGGAAAAAGTGTCTGAGCGTTCAGGTTACTCCAAATGGCACCTGCAACGGATGTTCAAAAAAGAGACCGGTCATTCAT
TAGGCCAGTACATCCGCAGCCGTAAAATGACCGAAATAGCGCAGAAATTAAAAGAAAGTAACGAGCCGATTTTATATCTG
GCCGAGCGCTACGGTTTTGAGTCGCAGCAGACGCTGACCCGGACCTTTAAAAACTATTTCGACGTGCCGCCGCATAAATA
CCGTATTACCAATATGCATGGCGAATCGCGTTACCTGCATCCGTTGAATCACTGTAACTAA

Protein sequence :
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRITNMHGESRYLHPLNHCN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 5e-21 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 5e-21 43
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_003365090.1 multiple antibiotic resistance regulatory protein CP001138.1.gene1637. Protein 3e-54 98
marA YP_003365090.1 multiple antibiotic resistance regulatory protein BAC0560 Protein 6e-55 97
marA YP_003365090.1 multiple antibiotic resistance regulatory protein NC_002695.1.917339.p Protein 6e-55 97
marA YP_003365090.1 multiple antibiotic resistance regulatory protein CP000034.1.gene1596. Protein 8e-55 97
marA YP_003365090.1 multiple antibiotic resistance regulatory protein CP001918.1.gene2033. Protein 6e-54 95
marA YP_003365090.1 multiple antibiotic resistance regulatory protein CP000647.1.gene1624. Protein 6e-53 95
marA YP_003365090.1 multiple antibiotic resistance regulatory protein NC_010558.1.6276025. Protein 2e-21 43
marA YP_003365090.1 multiple antibiotic resistance regulatory protein CP001138.1.gene612.p Protein 9e-23 42
marA YP_003365090.1 multiple antibiotic resistance regulatory protein BAC0371 Protein 1e-19 42
marA YP_003365090.1 multiple antibiotic resistance regulatory protein CP001138.1.gene4488. Protein 4e-20 42
marA YP_003365090.1 multiple antibiotic resistance regulatory protein NC_002695.1.914293.p Protein 1e-19 42
marA YP_003365090.1 multiple antibiotic resistance regulatory protein CP000034.1.gene4505. Protein 2e-19 42
marA YP_003365090.1 multiple antibiotic resistance regulatory protein CP001918.1.gene327.p Protein 3e-20 42
marA YP_003365090.1 multiple antibiotic resistance regulatory protein CP000647.1.gene4499. Protein 7e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_003365090.1 multiple antibiotic resistance regulatory protein VFG1038 Protein 2e-21 43
marA YP_003365090.1 multiple antibiotic resistance regulatory protein VFG0585 Protein 4e-20 42