Gene Information

Name : ECSF_P1-0102 (ECSF_P1-0102)
Accession : YP_003352430.1
Strain :
Genome accession: NC_013655
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 85040 - 85387 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
TTGATCCCATTACCATCAGGGACAAAGATCTGGCTGGTCGCTGGCATCACCGATATGAGAAACGGCTTCAACGGCCTGGC
GGCAAAGGTGCAGACGACGCTGAAAGACGATCCGATGTCAGGTCACGTTTTTATCTTCCGTGGGCGTAATGGCAGTCAGG
TAAAGCTCCTCTGGTCTACCGGCGATGGACTGTGTCTGCTGACCAAACGGCTGGAGCGCGGCCGCTTCGCCTGGCCGTCA
GCCCGGGATGGCAAAGTGTTCCTCACACCGGCACAGCTGGCGATGCTCCTTGAAGGTATCGACTGGCGGCAGCCTAAAAG
ACTGCTTACGTCCCTGACTATGTTGTAA

Protein sequence :
MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTTLKDDPMSGHVFIFRGRNGSQVKLLWSTGDGLCLLTKRLERGRFAWPS
ARDGKVFLTPAQLAMLLEGIDWRQPKRLLTSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-49 100
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-49 100
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-48 98
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-48 98
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-48 98
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-48 98
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-48 98
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-48 98
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-48 98
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-48 98
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 5e-36 97
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-47 97
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-47 97
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-48 96
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 9e-40 77
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 9e-40 77
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-39 76
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-37 72
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-37 72
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-29 68
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-34 66
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-34 66
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 5e-35 65
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 5e-35 65
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-35 64

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECSF_P1-0102 YP_003352430.1 hypothetical protein VFG1698 Protein 9e-50 100
ECSF_P1-0102 YP_003352430.1 hypothetical protein VFG1709 Protein 6e-49 98
ECSF_P1-0102 YP_003352430.1 hypothetical protein VFG0792 Protein 6e-49 98
ECSF_P1-0102 YP_003352430.1 hypothetical protein VFG1517 Protein 2e-36 97
ECSF_P1-0102 YP_003352430.1 hypothetical protein VFG1052 Protein 1e-48 96
ECSF_P1-0102 YP_003352430.1 hypothetical protein VFG1665 Protein 8e-40 76
ECSF_P1-0102 YP_003352430.1 hypothetical protein VFG1737 Protein 2e-35 64