Gene Information

Name : Dd586_0644 (Dd586_0644)
Accession : YP_003332242.1
Strain : Dickeya dadantii Ech586
Genome accession: NC_013592
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 718352 - 719074 bp
Length : 723 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: kpe:KPK_3672 DNA-binding response regulator

DNA sequence :
ATGAATAGCGCAAGAAAAATACTGCTGGTAGAAGATGACCACGATATCGCCACGCTACTGCGGTTAAATCTGCAGGATGA
GGGCTACCAGATTAGCCATGAGGTGAATGGAGCGCATGCACTGGTTCAGTTGGAAAAACAGGTCTGGGATGCCGTAATCC
TCGATTTGATGCTACCCGGTGTAGATGGGCTTGAGATTTGCCGCCGCATTCGTCAGATGACCCACTACTTACCCGTGATC
ATCATCAGCGCTCGAACCAGCGAAACTCACCGGGTTCTCGGGCTGGAAATGGGAGCGGACGACTATCTGCCTAAACCGTT
TTCGGTGCTGGAATTAGTTGCCCGGGTCAAAGCCCTGTTTCGTCGTCAGGAGGCAATGGGACAGAATATCCGTATGGAAG
CAGGCTCCGTCTCCCTTCACGGGCTGGATATCGACCCACTGGCACGGGAGGTGTCACTGCATGGCAAGCCGATAGAGCTG
ACGCCACGCGAATTCGATCTCCTTTACTGGTTTGCCCGCCATCCGGGAGAAGTTTTTTCACGACTGACACTGCTCGATCG
CGTGTGGGGATATCAGCACGAAGGCTATGAGCATACGGTCAATACCCATATCAACCGACTACGAATCAAGATCGAACGTA
ACCCCGCCGAGCCAGAGATTATCCTTACCGTTTGGGGAAAGGGGTACAAATTTGCTACCAACAAACCGGAGTCGCAGCCA
TGA

Protein sequence :
MNSARKILLVEDDHDIATLLRLNLQDEGYQISHEVNGAHALVQLEKQVWDAVILDLMLPGVDGLEICRRIRQMTHYLPVI
IISARTSETHRVLGLEMGADDYLPKPFSVLELVARVKALFRRQEAMGQNIRMEAGSVSLHGLDIDPLAREVSLHGKPIEL
TPREFDLLYWFARHPGEVFSRLTLLDRVWGYQHEGYEHTVNTHINRLRIKIERNPAEPEIILTVWGKGYKFATNKPESQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-88 76
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-88 76

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-44 46
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 9e-39 43
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-42 42
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 1e-29 42
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator BAC0533 Protein 1e-29 42
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-36 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-36 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-36 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-36 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-36 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-36 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-36 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-36 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-30 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 7e-43 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-40 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 1e-29 41
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator VFG1563 Protein 6e-89 76
Dd586_0644 YP_003332242.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-88 76