
|
Name : Dd586_0404 (Dd586_0404) Accession : YP_003332005.1 Strain : Dickeya dadantii Ech586 Genome accession: NC_013592 Putative virulence/resistance : Virulence Product : phage transcriptional regulator AlpA Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 462842 - 463054 bp Length : 213 bp Strand : - Note : PFAM: Prophage CP4-57 regulatory; KEGG: pct:PC1_2878 phage transcriptional regulator, AlpA DNA sequence : ATGACCAGCGAACCCAGTCTGCTCAAAGATCAATTCGTCGATATGGCGTTTATCACCAAATTGACCGGATTAACCGACAA ATGGTTTTACAAGCTGATTCAGGACGGCACATTTCCACCCCCCATCAAATTTGGTCGCCGCTCCCGCTGGCTGCAAAGTG AAGTGGAAGCCTGGCTCCAGCGCCGTATCGAACAATCCCGAGTATCACAATGA Protein sequence : MTSEPSLLKDQFVDMAFITKLTGLTDKWFYKLIQDGTFPPPIKFGRRSRWLQSEVEAWLQRRIEQSRVSQ |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 6e-21 | 78 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 1e-20 | 77 |
| unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 4e-20 | 77 |
| unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 4e-20 | 77 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-20 | 75 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-20 | 75 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 9e-21 | 75 |
| unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 2e-20 | 74 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 1e-16 | 58 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 2e-16 | 58 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Dd586_0404 | YP_003332005.1 | phage transcriptional regulator AlpA | VFG0651 | Protein | 4e-21 | 75 |
| Dd586_0404 | YP_003332005.1 | phage transcriptional regulator AlpA | VFG1057 | Protein | 1e-20 | 74 |
| Dd586_0404 | YP_003332005.1 | phage transcriptional regulator AlpA | VFG1480 | Protein | 5e-17 | 58 |