Gene Information

Name : Dd586_2885 (Dd586_2885)
Accession : YP_003334425.1
Strain : Dickeya dadantii Ech586
Genome accession: NC_013592
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator AlpA
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3260404 - 3260613 bp
Length : 210 bp
Strand : -
Note : PFAM: Prophage CP4-57 regulatory; KEGG: pct:PC1_2878 phage transcriptional regulator, AlpA

DNA sequence :
ATGATGACGACCAAACCAACCTTGCTCGAAGACCAATTTGTCAATATGGCTTTTATTACTCGCCTGACGGGATTAACCGA
TAAATGGTTTTATAAGCTCATCAAAGACGGGGAGTTTCCGAAACCCATTAAACTGGGACGTAGCTCACGCTGGCTGCAAA
GCGAAGTGGAAGCCTGGTTACAGGAACGTATTACACGCTCCCGCGCCTAA

Protein sequence :
MMTTKPTLLEDQFVNMAFITRLTGLTDKWFYKLIKDGEFPKPIKLGRSSRWLQSEVEAWLQERITRSRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 5e-22 78
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 3e-21 74
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 3e-21 74
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 2e-21 74
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 2e-21 74
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 7e-22 74
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 7e-22 74
unnamed AAL08466.1 unknown Not tested SRL Protein 2e-21 72
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 3e-14 66
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 3e-14 66
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-17 65
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 2e-17 65

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd586_2885 YP_003334425.1 phage transcriptional regulator AlpA VFG0651 Protein 8e-22 74
Dd586_2885 YP_003334425.1 phage transcriptional regulator AlpA VFG1057 Protein 6e-22 72
Dd586_2885 YP_003334425.1 phage transcriptional regulator AlpA VFG1480 Protein 6e-18 65