Name : Dd586_2885 (Dd586_2885) Accession : YP_003334425.1 Strain : Dickeya dadantii Ech586 Genome accession: NC_013592 Putative virulence/resistance : Virulence Product : phage transcriptional regulator AlpA Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3260404 - 3260613 bp Length : 210 bp Strand : - Note : PFAM: Prophage CP4-57 regulatory; KEGG: pct:PC1_2878 phage transcriptional regulator, AlpA DNA sequence : ATGATGACGACCAAACCAACCTTGCTCGAAGACCAATTTGTCAATATGGCTTTTATTACTCGCCTGACGGGATTAACCGA TAAATGGTTTTATAAGCTCATCAAAGACGGGGAGTTTCCGAAACCCATTAAACTGGGACGTAGCTCACGCTGGCTGCAAA GCGAAGTGGAAGCCTGGTTACAGGAACGTATTACACGCTCCCGCGCCTAA Protein sequence : MMTTKPTLLEDQFVNMAFITRLTGLTDKWFYKLIKDGEFPKPIKLGRSSRWLQSEVEAWLQERITRSRA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 5e-22 | 78 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-21 | 74 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-21 | 74 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 2e-21 | 74 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 2e-21 | 74 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 7e-22 | 74 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 7e-22 | 74 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 2e-21 | 72 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 3e-14 | 66 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 3e-14 | 66 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 2e-17 | 65 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 2e-17 | 65 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Dd586_2885 | YP_003334425.1 | phage transcriptional regulator AlpA | VFG0651 | Protein | 8e-22 | 74 |
Dd586_2885 | YP_003334425.1 | phage transcriptional regulator AlpA | VFG1057 | Protein | 6e-22 | 72 |
Dd586_2885 | YP_003334425.1 | phage transcriptional regulator AlpA | VFG1480 | Protein | 6e-18 | 65 |