Gene Information

Name : Xcel_2514 (Xcel_2514)
Accession : YP_003327087.1
Strain : Xylanimonas cellulosilytica DSM 15894
Genome accession: NC_013530
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2743499 - 2744179 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bcb:BCB4264_A5589 DNA-binding response regulator YycF

DNA sequence :
ATGAAGTCCCGCGTTCTTGTGGTCGACGACGACACTGCGCTGGCCGAGATGATCGGCATGGTTCTGCGCACCGAAGGGTT
CGACCCGGTCTTCTGCGCCGACGGTGACGGCGCACTCGCCGCGTTCCGTTCCGCGCAGCCGGACATCGTGCTGCTCGACG
TCATGCTCCCCGGCAAGGACGGCACCCAGGTGGCGCGCGAGATCCGCGCCGAGTCCGGCGTGCCGATCATCATGCTCACC
GCCAAGTCCGACACGGTCGACGTCGTGCTGGGCCTCGAGTCCGGCGCCGACGACTACGTGCCCAAGCCCTTCAAGCCCAA
GGAGCTCGTGGCCCGCATGCGGGCCCGGCTGCGCCGCCAGGAGGACCCCGGCCCCGAACGGCTGCTCGTCGGCGACCTCG
AGATCGACGTCACCGGCCACACGGTCACCCGCGCCGGCGGACGCATCAGCCTCACGCCGCTCGAGTTCGACCTGCTGGTC
GCCCTGGCCCGCAAGCCCTGGCAGGTGTTCACGCGCGAGGTGCTGCTGGAGAAGGTCTGGGGCTACCGGCACTCGGCCGA
CACCCGGCTGGTCAACGTGCACGTGCAGCGGCTGCGCTCCAAGGTCGAGCGCGACCCCGAGAACCCCGAGATCGTCCTGA
CGGTGCGCGGGGTCGGGTACAAGGCGGGCGCACCGCGGTGA

Protein sequence :
MKSRVLVVDDDTALAEMIGMVLRTEGFDPVFCADGDGALAAFRSAQPDIVLLDVMLPGKDGTQVAREIRAESGVPIIMLT
AKSDTVDVVLGLESGADDYVPKPFKPKELVARMRARLRRQEDPGPERLLVGDLEIDVTGHTVTRAGGRISLTPLEFDLLV
ALARKPWQVFTREVLLEKVWGYRHSADTRLVNVHVQRLRSKVERDPENPEIVLTVRGVGYKAGAPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-73 73
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-45 47
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator BAC0125 Protein 4e-35 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-43 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-40 44
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-30 41
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-34 41
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-34 41
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-34 41
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-34 41
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-34 41
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-34 41
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-34 41
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-34 41
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-34 43
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-29 43
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-36 42
Xcel_2514 YP_003327087.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-36 41