Gene Information

Name : Tter_1098 (Tter_1098)
Accession : YP_003322836.1
Strain :
Genome accession: NC_013525
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1183365 - 1184051 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: gbm:Gbem_0243 two component transcriptional regulator, winged helix family

DNA sequence :
TTGGAAAGACCTCTAATCCTTGTAATAGATGATGACAAGAATATCACAAGCTTTCTAAGGAGAGCGCTATCCTACGCTGG
ATATGAAGTCAAAACTGCACACAATGGACAAGAAGGACTACAGGTAGCCTTATCTAATGCTCCGGATCTTGTGATACTTG
ACTGGTTAATGCCAGATATGGATGGCATAGAGGTATGCAAAAGACTCCGCTCAGCGGACAATATACCAATACTAATGCTG
ACGGCAAAGGACGAAGTATCCGACCGAGTGCAGGGGCTGGAGGCGGGAGCGGATGATTATCTTGTAAAACCCTTCGCACA
TGAGGAACTAATCGCCCGAGTGAAGGCTCTCCTGAGACGAGCCTCACCAGACTCGAGAAAAGTGCTGCGATTCGCTGACC
TTTCGGTCGATTTGGGGACCAGAGAGGTCAAAAGAGGTCAAAGAGTCATAGATCTAACAGCTAAGGAATTTGATCTATTG
GTTACCTTCATGCAACATCCCAGGCAGGTGCTAACCAGAGATCAGCTTTTGCAGATCGTGTGGGGTTTCGATATGGAGGT
TGAATCTCACGTAGTAGCAGTTTACGTAGGATACCTAAGAGACAAACTGGAAGCAGGAGGGGAGTCCAGACTTATTCATA
CTTTGAGGGGCGTAGGATACGTTCTTAGGGAGTCTAACGAGAAATGA

Protein sequence :
MERPLILVIDDDKNITSFLRRALSYAGYEVKTAHNGQEGLQVALSNAPDLVILDWLMPDMDGIEVCKRLRSADNIPILML
TAKDEVSDRVQGLEAGADDYLVKPFAHEELIARVKALLRRASPDSRKVLRFADLSVDLGTREVKRGQRVIDLTAKEFDLL
VTFMQHPRQVLTRDQLLQIVWGFDMEVESHVVAVYVGYLRDKLEAGGESRLIHTLRGVGYVLRESNEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-47 46
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family BAC0083 Protein 3e-41 45
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family BAC0638 Protein 9e-37 45
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-40 45
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family BAC0347 Protein 8e-38 44
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family BAC0125 Protein 8e-41 44
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-40 44
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-38 44
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family BAC0111 Protein 4e-41 43
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family BAC0308 Protein 1e-39 43
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 2e-34 43
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-47 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-47 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-47 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-47 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-47 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-47 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 5e-42 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-47 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-47 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 5e-38 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-41 42
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-38 41
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-38 41
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family NC_008702.1.4607594. Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-61 57
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family VFG1389 Protein 7e-48 50
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family VFG1386 Protein 7e-44 46
Tter_1098 YP_003322836.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-35 41