Gene Information

Name : Sthe_0910 (Sthe_0910)
Accession : YP_003319169.1
Strain :
Genome accession: NC_013523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1000498 - 1001220 bp
Length : 723 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sru:SRU_2488 response regulator DrrA

DNA sequence :
GTGGCGGATATTGTCGTCGTCGAGGACGAGCGGGAGTTGGCGACCCTGGTTGAGCGGGCGCTGCGTGAGGAGGGGCACCG
GGTCGAGGTCATCCGCGATGGGGCTGCGGCGCTTGAGCGGCTGACCGGTCCTGGCCAGCCGGAGCCGGACCTGATCGTGC
TCGATCTGATGCTCCCCAACGTTGACGGGCTGGAGATCTGCCGCCGTGTGCGGCAGTCGAAGATCACGCCGATCCTGATG
CTGACGGCCCGGTCGACGGAGCTGGACCGTGTGCTCGGTCTGGAGCTCGGCGCGGATGACTATCTGACCAAGCCCTTCTC
GCTGCGGGAGCTGCAGGCGCGCGTCTCGGCGATCCTGCGCCGGGTGGAGATGATGCGGGCGCTCTCGCGCACCGAGGACG
GCACGACGCGGATCGATCACGGCGACCTGACGATCGATCCCCTCTCGCGGGAAGTGACGTCGCGCGGGCAACCGGTGCAC
CTGACGGCCAAAGAGTTCGACCTCTTGCACCTCCTGGCGGCCAACCCCGGGCGGGTCTTCAGCCGCGACTACCTCCTGCA
TCGCGTCTGGGGTGAGGACTACGTCGGCGTCGATCGAACGGTGGACACGCATATCCTCCGGCTGCGCAAGAAGCTGGGCG
GACCGGGTAGCCCGGCCGAGCGGATCGTTACCTTGTGGGGCGTCGGCTACAAGTACGAACGACCGCGTGACGGAGGGGCG
TGA

Protein sequence :
MADIVVVEDERELATLVERALREEGHRVEVIRDGAAALERLTGPGQPEPDLIVLDLMLPNVDGLEICRRVRQSKITPILM
LTARSTELDRVLGLELGADDYLTKPFSLRELQARVSAILRRVEMMRALSRTEDGTTRIDHGDLTIDPLSREVTSRGQPVH
LTAKEFDLLHLLAANPGRVFSRDYLLHRVWGEDYVGVDRTVDTHILRLRKKLGGPGSPAERIVTLWGVGYKYERPRDGGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-40 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-40 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 9e-42 48
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 6e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 5e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 4e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-46 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-44 46
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 5e-30 44
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 7e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family BAC0533 Protein 1e-33 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 1e-33 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family BAC0596 Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family BAC0039 Protein 4e-36 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 1e-35 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 4e-36 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 3e-36 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 4e-32 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 4e-38 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 3e-38 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 3e-38 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 1e-35 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-39 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 5e-43 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 4e-41 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 9e-34 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 9e-34 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 9e-34 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 4e-35 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 1e-34 42
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 1e-37 41
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 1e-34 41
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-27 41
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 7e-34 41
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family NC_008702.1.4607594. Protein 1e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family VFG1563 Protein 3e-40 45
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family VFG1702 Protein 8e-41 44
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family VFG1389 Protein 6e-26 43
Sthe_0910 YP_003319169.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-34 42