Gene Information

Name : Sthe_0751 (Sthe_0751)
Accession : YP_003319010.1
Strain :
Genome accession: NC_013523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 833970 - 834644 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: mta:Moth_1478 two component transcriptional regulator

DNA sequence :
ATGGCCATCCTGGTAGTCGAAGACGAGCAACGCCTGGCGCGCCTGCTGCAGCGCGTGCTCCAGGACGAGGGGCACACGGT
CCATCTCGCGTACGACGGTGTCACCGGCCTCGACATGGCGCTGCGCGGCGACTATGACCTCGCGATCCTTGACCTCATGC
TCCCGGACCTGGACGGCGTCGAGATCTGCCGCCACTTGCGCGCCGCTCGGGTGCGGACACCCATCCTCATGCTCACGGCT
CGGGGCGCGGTCGAGGATCGGGTCACGGGGTTGAACGCCGGGGCGGACGACTACCTGGTAAAGCCGTTCGCCATGGCGGA
GCTGGTGGCGAGAGTCAACGCACTGCTCCGGCGCGCCCGGGGCACGGACGGCCCGCCGACGATCCTGCAGGTTGCCGACC
TCACGCTCGATCTCCTCCGGCATGAGGCGCGCCGCGGCGGGCAGGTGATCGAACTCACACCGAAAGAGTTCGCCCTGCTC
GAGTACCTCATGCGCAACCCCGGGCGGGCGCTCACCCGCTCGCAGATCATCGATCGAGTCTGGCAGTACGACCTCGACTC
GCTCTCGAACGTGGTCGATATCTACATCCACTACCTGCGCGACAAGATTGACCGTGGCTTCGACCGCCCGCTCATCAAGA
CGGTGCGCGGCGTCGGCTACAAGATCGAGGGCTAG

Protein sequence :
MAILVVEDEQRLARLLQRVLQDEGHTVHLAYDGVTGLDMALRGDYDLAILDLMLPDLDGVEICRHLRAARVRTPILMLTA
RGAVEDRVTGLNAGADDYLVKPFAMAELVARVNALLRRARGTDGPPTILQVADLTLDLLRHEARRGGQVIELTPKEFALL
EYLMRNPGRALTRSQIIDRVWQYDLDSLSNVVDIYIHYLRDKIDRGFDRPLIKTVRGVGYKIEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-33 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-32 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family BAC0111 Protein 2e-38 51
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-34 51
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family BAC0083 Protein 4e-38 50
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family BAC0308 Protein 4e-32 49
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 7e-33 48
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 7e-33 48
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 7e-33 48
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 7e-33 48
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 7e-33 48
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 7e-33 48
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 7e-33 48
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 7e-33 48
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family BAC0125 Protein 6e-33 48
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 5e-37 47
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 4e-29 46
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family BAC0347 Protein 8e-33 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-31 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family BAC0638 Protein 5e-27 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-31 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-31 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-31 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-31 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-31 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-31 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-31 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-31 44
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-30 42
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family BAC0487 Protein 8e-21 41
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 6e-21 41
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-32 41
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-35 41
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 3e-20 41
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-29 41
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 3e-16 41
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 3e-16 41
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 3e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-38 50
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-33 46
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-27 45
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family VFG0473 Protein 3e-26 43
Sthe_0751 YP_003319010.1 two component transcriptional regulator, winged helix family VFG1386 Protein 9e-33 43