Gene Information

Name : Sthe_0369 (Sthe_0369)
Accession : YP_003318630.1
Strain :
Genome accession: NC_013523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 409490 - 410191 bp
Length : 702 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: lac:LBA0078 putative response regulator

DNA sequence :
GTGGCGCGGATCCTCGTCGTCGAGGATGAAGCAAGTATCCGCACGACGATCGCATACAACCTCAAAAAGGCGGGGCACGA
CGTGCGCACCGTCGCCGACGGCGAGGCCGCCATCGCTCAGGCCAACGCCGACCCGCCCGATCTGGTCATCCTCGACATCA
TGCTCCCCACCATCGACGGCTTCGATGTCTGCCGACACATCCGCCGTTCTAGCTCGGTGCCAATCCTCATGCTCACCGCG
CGAGACGATGAGGTCGACCGCGTCGTCGGCCTGGAGATCGGGGCCGACGACTACGTCACAAAGCCCTTCTCGATGCGAGA
ACTTATGGCCCGCGTCAAAGCGCTCCTGCGCCGCCGCGAGCTGCTGGAGCAGGAACTCGCCAGCAACCCGGACGGCCGGG
AGGAAGTCTTCGAGATCGGCACCCTGCGCATCGACCCGGCCGCCTACCGCGTGACCCGCAACGGCCGCGAGGTTCAGCTC
ACGCCCAAAGAGATGGACTTGCTGGTCTACCTCGCCCGGCACCGGGGAAACGTCTGCCCAACCCGCCGGATCCTCGAGGC
GGTCTGGGGGTACGACTACTACGGCGACAACCGCACCGTGGCCGTGCATATCCATGGCCTGCGAGAGAAACTGGAGGAAG
ACCCGCGCCAGCCCCGGCTGATCGAGACGGTTCGCGGCGTGGGGTATCGCCTGGCAGGGTAG

Protein sequence :
MARILVVEDEASIRTTIAYNLKKAGHDVRTVADGEAAIAQANADPPDLVILDIMLPTIDGFDVCRHIRRSSSVPILMLTA
RDDEVDRVVGLEIGADDYVTKPFSMRELMARVKALLRRRELLEQELASNPDGREEVFEIGTLRIDPAAYRVTRNGREVQL
TPKEMDLLVYLARHRGNVCPTRRILEAVWGYDYYGDNRTVAVHIHGLREKLEEDPRQPRLIETVRGVGYRLAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 7e-52 52
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 5e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 5e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 5e-52 49
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-51 48
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-40 48
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 8e-44 46
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-46 44
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-41 44
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 3e-39 44
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-45 44
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-31 43
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-33 42
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 3e-38 42
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family BAC0083 Protein 6e-33 41
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 2e-37 41
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-30 45
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-34 42
Sthe_0369 YP_003318630.1 two component transcriptional regulator, winged helix family VFG1563 Protein 3e-36 41